Gilera fuoco: Купить Gilera Fuoco 500ie с пробегом: продажа скутеров Гилера Фуоко 500 б/у

Содержание

Gilera Fuoco. Управляемый наклон

Gilera, существующая сегодня под крышей Piaggio, уже достаточно давно представила миру оригинальный трехколесный скутер под названием Fuoco. Но до сих пор многие стараются понять, как же у него, у Fuoco, работает передняя подвеска

Игорь Владимиров

Gilera, существующая сегодня под крышей Piaggio, уже достаточно давно представила миру оригинальный трехколесный скутер под названием Fuoco. Но до сих пор многие стараются понять, как же у него, у Fuoco, работает передняя подвеска

На самом деле принцип работы передней подвески прост, как все гениальное. Конечно, лучше все видеть воочию, и тогда вопросов возникать не должно. Но не у всех есть возможность заглянуть под «кринолин» Fuoco. Поэтому мы предложим «рентгеновский снимок» этого скутера, где хорошо виден принцип работы. В повороте конструкция, расположенная над элементами передней подвески, «складывается», причем верхняя часть «уходит» в сторону поворота. Именно за счет этого и обеспечивается наклон всего скутера. Передние колеса ведут независимый образ жизни, у каждого своя подвеска и свой амортизатор. Специальное электронное устройство может заблокировать наклон скутера. При заблокированной системе наклона скутер управляется по тому же принципу, что и квадроцикл. То есть мы поворачиваем руль, колеса, естественно, тоже поворачиваются, но наклона, привычного для обладателей скутеров и мотоциклов, нет. Сидим, как говорится, на попе ровно и тупо рулим в том направлении, куда нам надо.

Отключив систему блокировки наклона, мы рискуем завалиться набок, так как система позволяет отключить блокировку даже при стоянке. В этом случае колеса стоят прямо по курсу, но скутер можно наклонить, вернее, он сам может наклониться.

Гидравлическая блокировка передней подвески автоматически выключается, когда скутер добирается до скорости 19 км/ч. Это удобно, и не стоит заморачиваться с ее выключением, после троганья с места, к примеру на светофоре. С другой стороны, блокировка позволяет обходиться без подножки. На стоянке можно включить блокировку и ручной тормоз (есть и стояночный тормоз у этого «трайка»), и скутер будет преспокойно стоять там, где его поставят, хоть день, хоть год.

Поскольку передние колеса не зависят друга от друга в вертикальной проекции, то наезды на препятствия одним колесом никак не влияют на скутер: амортизатор с пружиной «отработали» ямку или камень, а Fuoco как ехал, так и едет. Второе колесо, которое, к примеру, не попало в ухаб, возьмет часть нагрузки на себя, даже в повороте, и удара, который был бы при классической схеме, не последует.

При движении по мокрому асфальту или диабазу два передних колеса обеспечивают хорошее сцепление с поверхностью движения. Тоже плюс, так как поскользнуться на Fuoco не то что невозможно, но постараться придется.

Так как каждое колесо имеет свой тормозной механизм, торможение у скутера проходит плавно и до блокировки тормозов дело, как правило, не доходит. Словом, остановиться на этом аппарате можно аккуратно и без эксцессов почти в любой ситуации, не используя ножной тормоз.

При длительном рулении на малых скоростях руки с непривычки устают. Оно и понятно, повернуть вместо одного колеса два, да еще с кучей дополнительных муфт и шарниров, тяжелее. Вот если бы усилитель… Но это уже будет лишним. Не наш путь. Пусть руки натренируются, а там и навык придет. При увеличении скорости усилие на руле снижается. Это по-нашему, по-пролетарски. Не хочешь напрягаться, катись быстрее.

 

Бесспорное преимущество перед двухколесными собратьями Fuoco имеет и на грунтовых дорогах и дорожках. В движении по неровным поверхностям в любом случае (за очень редким исключением) одно колесо будет иметь контакт с дорогой, причем неплохой. Вот и еще плюсик нарисовался.

В общем и целом, езда на этом аппарате может получиться зажигательной благодаря 41‑сильному мотору и уверенной благодаря параллелограммной передней подвеске, обеспечивающей хорошую устойчивость.

Хочу получать самые интересные статьи

Скутер Gilera Fuoco 2009 года

Популярный бренд Gilera представил на мотосалоне INTERMOT 2008 три новинки, одной из них стала модель скутера Gilera Fuoco 2009 модельного года.

Fuoco 2009 года – модный трехколесник от бренда, принадлежащего концерну Piaggio и потому сходного с аналогичным аппаратом Piaggio MP3.

Как отмечает сам производитель, Fuoco 500 ie – трехколесная версия в исполнении Gilera, предназначенная для тех, кто хочет выделиться. Дизайн этого скутера призван подчеркнуть силу и характер 492-кубового одноцилиндрового мотора. Двухколесный перед в качестве завершения снабжен стальным бампером с металлическими вставками, придающими аппарату немного грубый и нахмуренный вид.

Также скутер отличают металлические ручки и черные десятиспицевые диски. Передняя фара состоит из пяти лампочек, а обвес дает отличную аэродинамическую защиту. В то же время задняя часть выполнена в минималистском духе, правда при этом снабжена неплохим багажником и широким и удобным сиденьем.

Движок – 4-тактный, 4-клапанный, с жидкостным охлаждением и электронной системой зажигания. Максимальная мощность – 40 л.с. при 7 250 об./мин, максимальный крутящий момент – 42 Нм при 5 500 об. /мин. Степень сжатия – 10,5 к 1. Максимальная скорость по паспорту – 145-150 км/ч. Соответствие экологическому стандарту «Евро-3».

Ход передней подвески – 85мм, задней – 110мм. Спереди также имеется электро-гидравлическая система запирания подвески, благодаря которой скутер может стоять вертикально без центральной подставки. Эта система облегчает парковку, а также позволяет пилоту скутера не опускать ноги на землю во время остановок на светофорах.

Задние колесные диски 14 радиуса, передние двенадцатого. Три тормозных диска диаметром 240мм, с двухпоршневыми суппортами. Габариты – 2160х775х1550мм (длина, ширина, высота), высота сиденья – 785мм, вес – 244 кг, бак – 12 литров. Способен проехать на одном литре топлива 21 км. Цена этого приятного во всех отношениях аппарата в Европе – 7 920 евро в базовой комплектации. Цвета – черный, красный и темно-серый.

Мотовыставка INTERMOT 2008 проходит в Кельне (Германия) с 7 по 12 октября. Это первое осеннее европейское шоу двухколесной техники. Предыдущее аналогичное мероприятие проходило два года назад, тогда полюбоваться новинками мотомира в Кельн съехались 187 000 посетителей из 120 стран мира.

Среди участников выставки в этом году – все известные мировые производители мототехники, как крупные компании, так и мелкие ателье: Yamaha, BMW, Husqvarna, SYM, Aprilia, Piaggio, Suzuki, MV Agusta, BRP, Ducati, Kawasaki, Peugeot, KTM, Harley-Davidson, Triumph, Polaris, Honda, Kymco, Daelim, Malaguti и многие другие.

Больше комментариев

Хроники Магнитолы — Системы. Gilera Fuoco 500. Без помощи

Никто не знает, сейчас у школьников дневники есть? Я оказался как-то не в курсе: детям поздно, внукам — рано.
А если есть, что там, интересно, напечатано, кроме расписания уроков и итоговой ведомости оценок? Когда-то (ужас как давно) в конце были нормы ГТО, где самым волнующим пунктом я считал лазание по канату: отдельно с помощью ног, отдельно — без помощи. Без помощи давало значительно больше баллов.
Я вспомнил об этом, когда мне объяснили, как ездят на этом транспортном средстве, я такие видел на улицах, но до сих пор — не ближе соседнего ряда. И удивлялся, как на этом можно передвигаться: при двух довольно близкорасположенных колёсах спереди. Будь они расставлены пошире, получился бы трёхколёсный автомобиль, такие в самом деле время от времени появлялись под разными марками. Британский Morgan до 1936 года вообще делал только трёхколёсные машины, а здравствует поныне. С этим всё ясно, главное — не борзеть на поворотах.
Два колеса — тоже не бином Ньютона, там как раз крен — это их всё, без него — только по прямой. А здесь-то как? В общем, увидев на присланном снимке это чудо техники, я помчался смотреть на него без промедления. Всё оказалось даже интереснее, чем я мог предположить. На первый взгляд — игрушка. Симпатичная мультяшная зверушка, четвероглазая и четвероухая, которую так и хочется погладить. Считать это «мопедиком» (ну пусть скутером, теперь так больше принято) провоцирует и происхождение, стопроцентно итальянское: концерн Piaggio, марка Gilera, модель Fuoco 500, прямо слова из песни Челентано.
Если подходить к Fuoco 500 сзади — как есть скутер, только мощный. Одноцилиндровый (но четырёхклапанный) двигатель жидкостного охлаждения объёмом 495 «кубиков» вместе с бесступенчатой трансмиссией качается с подвеской заднего колеса и, если не страшно, разгоняет чудо-мопедик до 150 км/ч. Движок, разумеется, четырёхтактный, жечь на дорогах Европы масло даже в пропорции 1:50 никто теперь не позволит. Другое дело, если зайти спереди.
Здесь подвеска и рулевое управление почти как в автомобиле (скажем, марки Morgan). Рулевые тяги, сход-развал, независимая подвеска каждого колеса. Даже круче, колёса поворачиваются так, что ничем не препятствуют наклону в повороте, как у мотоцикла. Но это только когда «супермопедик» едет. А когда стоит, даже на светофоре, электрогидравлическая система блокирует переднюю подвеску, благодаря которой скутер стоит на своих трёх колёсах без помощи ног водителя. Стоит стронуться с места — блокировка снимается, и дальше всё происходит по-мотоциклетному. При массе «мопедика» 240 кг это весьма удобно, особенно когда за рулём не водитель, а водительница. Как в данном случае…
Всем была довольна водительница, освоив (за первые 15 минут) логику работы интеллектуального переднего моста. Единственное, чего не хватало — музыки. Не предусмотрели создатели такой опции, да и нам не велели: ни места нет, ни энергии. Генератор «по-мопедному» интегрирован в двигатель, и заменить его более мощным нельзя. Поэтому и структуру системы, и особенно компоненты пришлось выбирать тщательно.
Со структурой системы особо не мудрили — зачем изобретать велосипед, достаточно того, что изобрели итальянцы. Фронт, тыл, саб — схема известная. Без тыла на мотоциклах, независимо от колёсной формулы, ничего не получается, это проверено неоднократно. Фронт трёхполосный, на мотоциклах это не роскошь, а наиболее эффективное средство построения фронтальной акустики. Тыл двухполосный, с учётом серьёзности его вклада в общую звуковую картину.
Компоненты должны быть лёгкими, компактными, экономичными. И музыкальными. Не всё из современного удовлетворяло поставленным условиям — мне даже показалось, что Владимир и Игорь грабанули музей автозвука, адрес которого известен им одним.
Фронтальная акустика — сборная. Не раз оказывалось, что это наилучший способ получения требуемого результата при разумных затратах времени и сил.
Архитектурное решение фронта подчинили общей компоновке скутера, при этом и в акустическом плане получилось как нельзя лучше. Мидбас CDT Audio HD-M6 и среднечастотник Morel Hybrid Ovation 4mid встали рядышком в компактных каплевидных корпусах, обтекающих центральную консоль с рычагом ручного тормоза. Объём корпуса под мидбас всего 4 л, но в том и заключается особенность этого нечасто встречающегося нам динамика. Сочетание параметров у HD-M6 (резонансная частота 52 Гц, добротность — чуть больше 0,4) таково, что «на Баттерворта» он выходит уже в 6 л, а в 4-х работает с результирующей добротностью около 0,8, как многие динамики — в двери. Объём под «серединку» — совсем небольшой, иное здесь не потребовалось, благодаря близкому взаимному расположению излучателей частоту раздела НЧ и СЧ стало возможным выбрать довольно высокой, это к тому же позволяет уменьшить габариты кроссовера. Воспользовались готовым, с частотой раздела около 700 Гц. Динамики закрыли чёрными решётками от акустики Morel — они прекрасно вписались в общий стиль.
Как вы могли заметить, компоновка фронтальной акустики несколько выходит за рамки традиционных решений, когда СЧ и ВЧ-излучатели ставят близко, а НЧ — поодаль. Здесь вдалеке оказалось звено ВЧ, да и оно установлено своеобразно, такого решения я что-то не припомню. Пищалки спрятаны так, что сразу и не разглядеть. Звук излучается через щель между панелью приборов и ветровым щитком, при этом щиток тоже является элементом акустической системы, концентрируя излучение в направлении ушей водителя. Решение остроумное, элегантное и, как потом оказалось, эффективное.
Тыловое акустическое звено — вполне традиционное по компоновке, но самое сложное в исполнении. Компактный с виду центральный кофр, изготовленный целиком из стеклопластика, вместил три отдельных отсека: 36 л для сабвуфера и два раза по 5 л для тыловой акустики. Разрази меня гром, но распихать 46 л в этих габаритах можно только с применением неевклидовой геометрии… Корпус напоминает букву «П», которую Лобачевский и Риман сначала тянули в разные стороны, а потом гнули и плющили. В углубление образовавшейся геометрической фигуры встал двенадцатидюймовый Polk Audio MM1240, а по бокам — мидбасы Polk Audio MMC 5250. Пищалки из комплекта установлены без затей на плоскость выше мидбасов.
При выбранной структуре тракта трудно найти усилитель компактнее и экономичнее, чем Alpine PDX5, его пять каналов пришлись в самый раз. Усилитель вместе с источником сигнала Pioneer DEH-4200SD разместили под сиденьем, а на руль вывели пульт дистанционного управления и разъём для подключения iPod, iPhone и иже с ними…
После завершения музыкального оформления поработали и над внешним видом. Стальной трубчатый «подбородок» бампера придавал аппарату вызывающее и немного нахмуренное «выражение лица». Для усиления впечатления на верхних фарах поставили «веки» — косые заслонки. В таком виде аппарат эксплуатировался около года, а затем часть поверхностей отделали «под золото». Когда это произошло, Игорь и Владимир окрестили своё детище «убийцей голдвингов». Почему? Да очень просто, звучит аппарат намного громче и приятнее, чем многие японские тяжеловесы, взглядов привлекает как минимум не меньше, а ездить удобнее, поскольку «без помощи ног». ..

RTA
Когда нет салона, нет и его передаточной функции, поэтому и ход АЧХ более напоминает домашнюю акустику, нежели автомобильную. Причём — хорошую домашнюю, обратите внимание. Система запросто и без потерь доигрывает до 50 Гц, ниже интенсивность излучения, разумеется, быстро падает, но иное в «чистом поле» и невозможно. Зато то же самое «чистое поле» благотворнейшим образом сказалось на частотной характеристике в области средних частот: где нет салона, нет и салонных резонансов, АЧХ получается такой, какую могут обеспечить излучатели при условии грамотного сопряжения частотных полос и чувствительности головок. Нетрудно заметить, что эта часть работы была выполнена безукоризненно. Здесь явно не обошлось без помощи рук, головы и ушей.

SQ
Сцена — великолепная, высокая и стабильная. И довольно широкая, чего я никак не ожидал. Это следствие фокуса с пищалками, причём в обоих смыслах слова «фокус».
Тональный баланс ровный, без замечаний. Суббас и бас звучат мягко, без напряжения, середина выразительная и детальная, верхние частоты без надрыва, очень ясные и тёплые. Общее впечатление — почти как дома.

SUM
Тип системы: аудио
Состав: 3-полосный фронт + 2-полосный тыл + сабвуфер
Источник: Pioneer DEH-4200SD + iPod /iPhone
Усилитель: Alpine PDX5
Акустика: CDT Audio HD-M6, Morel Hybrid Ovation 4mid, Rockford Fosgate T1T, Polk Audio MMC 5250
Сабвуфер: Polk Audio MM1240

Студия: GL-Audio
Руководители проекта: Владимир Шорохов и Игорь Гоглов

Источник: журнал Автозвук, 07/2011

инструкция Gilera Fuoco 500ie

  • Page 1: Gilera Fuoco 500ie

    GILERA WOULD LIKE TO THANK YOU for choosing one of its products. We have prepared this manual to help you to get the very best from your scooter. Please read it carefully before riding the scooter for the first time. It contains information, tips and precautions for using your scooter. It also describes features, details and devices to assure you t[…]

  • Page 2: Gilera Fuoco 500ie

    The instructions given in this manual are intended to provide a clear, simple guide to using your scooter; this booklet also details routine maintenance procedures and regular checks that should be carried out on the vehicle at an authorised Dealer or Service Centre . The booklet also contains instructions for simple repairs. Any operations not spe[…]

  • Page 3: Gilera Fuoco 500ie

    Personal safety Failure to completely observe these instructions will result in serious risk of personal injury. Safeguarding the environment Sections marked with this symbol indicate the correct use of the vehicle to prevent dam- aging the environment. Vehicle intactness The incomplete or non-observance of these regulations leads to the risk of se[…]

  • Page 4: Gilera Fuoco 500ie

    4[…]

  • Page 5: Gilera Fuoco 500ie

    INDEX VEHICLE ……………………………………………………………….. ………… 7 Dashboard …………………………………………………………………….. 9 Analogue instrument panel ………………………………………………. 11 Clock ………………………………………………………[…]

  • Page 6: Gilera Fuoco 500ie

    Headlight adjustment ……………………………………………………. 64 Front direction indicators ………………………………………………….. 67 Rear optical unit ……………………………………………………………… 68 Rear turn indicators …………………………………………………..[…]

  • Page 7: Gilera Fuoco 500ie

    Fuoco 500ie Chap. 01 Vehicle 7[…]

  • Page 8: Gilera Fuoco 500ie

    01_01 8 1 Vehicle[. ..]

  • Page 9: Gilera Fuoco 500ie

    Dashboard (01_01) A = Ignition key-switch B = Hand brake C = Bag hook D = HAZARD button E = Horn button F = Turn indicator switch G = Rear brake lever H = Light switch + PASSING I = Analogue instrument panel L = Digital instrument panel M = Warning light unit N = RUN/OFF switch O = Front brake lever P = Throttle grip Q= Front suspension locking-unl[…]

  • Page 10: Gilera Fuoco 500ie

    01_02 10 1 Vehicle[…]

  • Page 11: Gilera Fuoco 500ie

    Analogue instrument panel (01_02) A = Immobilizer / antitheft LED B = Speedometer with twin scale (Km/h and Mph) C = CLOCK switch D = Digital display E = Front suspension locking system warning light F = SET switch G = Rpm indicator H = Fuel gauge I = Warning light for helmet compartment courtesy light on L = Engine control telltale light and injec[. ..]

  • Page 12: Gilera Fuoco 500ie

    01_03 Clock (01_03) Pushing the « CLOCK » button for less than 1 second displays the following sequence: • TIME • DATE To set the clock push and hold the « CLOCK » button longer than 3 seconds. The numbers showing the hours will begin flashing. Set the hour using the « SET » button. Push the « CLOCK » button again and the mi- nutes numb[…]

  • Page 13: Gilera Fuoco 500ie

    01_05 01_06 G = Low fuel warning light H = Trip odometer gauge (B) I = Trip odometer gauge (A) L = Kilometre — mile indicator M = « SET » button N = « CLOCK » button Maintenance icons The icons signal the user that scheduled maintenance operations should be carried out. A flashing « SERVICE » icon signals the need to carry out the scheduled m[. ..]

  • Page 14: Gilera Fuoco 500ie

    » Kmi » represents the combination of » km » (kilometres) and » mi » (miles) » °E » represents the combination of » °C » (degrees Celsius) and » °F » (degrees Fahren- heit). By pushing the » MODE » « S » button for less than a second, the icons » km » and » mi[…]

  • Page 15: Gilera Fuoco 500ie

    CAUTION DO NOT TURN THE KEY TO «LOCK» OR «OFF» WHILE RIDING. Releasing the steering wheel Reinsert the key « B » and turn it to « KEY OFF ». CAUTION DO NOT TURN THE KEY TO «LOCK» OR «OFF» WHILE RIDING. 01_09 Switch direction indicators (01_09) Lever « F » towards « 1 » = left turn indicators switched on; Lever « F » towards « 2 ?[…]

  • Page 16: Gilera Fuoco 500ie

    01_10 Horn button (01_10) Push the button « E » to sound the horn. 01_11 Light switch (01_11) When the light switch « H » is set to « 0 », the low-beam light is on. When set to « 1 », the high-beam light is activated. If the light switch « H » is pressed when set to « 2 », the high-beam light is activated. The switch goes back to « 0 ?[…]

  • Page 17: Gilera Fuoco 500ie

    01_13 Start-up button (01_13) To start the engine, press the starter button « R » after pulling one of the two brake levers. If the rider is not on the vehicle, the suspension lock will start the engine at idling speed. 01_14 Engine stop button (01_14) The engine can be started when the emergency cut-off switch « N » is set to « 1 » RUN ; if […]

  • Page 18: Gilera Fuoco 500ie

    01_16 01_17 01_18 The immobilizer system In order to enhance theft protection, the scooter is equipped with a « PIAGGIO IM- MOBILIZER » electronic engine locking device that is activated automatically when the starter key is removed. Upon start-up, the « PIAGGIO IMMOBILIZER » system checks the starter key, and only if this key is recognised wil[…]

  • Page 19: Gilera Fuoco 500ie

    01_19 WARNING KEEP THE «CODE CARD» AND THE RED HANDGRIP KEY IN A SAFE PLACE (NOT ON YOUR VEHICLE). Immobilizerdevice enabled indicator led (01_19) Activation of the » PIAGGIO IMMOBILIZER» system is signalled by a flashing « A » indicator. In order to reduce battery discharge, the indicator LED turns off automatically after 48 […]

  • Page 20: Gilera Fuoco 500ie

    WARNING EACH KEY HAS ITS OWN AND UNIQUE CODE, WHICH MUST BE STORED BY THE SYSTEM CONTROL UNIT. VIOLENT SHOCKS MAY AFFECT THE ELECTRONIC COMPONENTS OF THE KEY. IF THE VEHICLE IS SOLD, THE MASTER-HANDGRIP KEY (AS WELL AS THE OTHER STARTER KEYS) AND THE «CODE CARD» MUST ALSO BE TRANSFER- RED TO THE NEW OWNER. Programming the immobilizer syst[…]

  • Page 21: Gilera Fuoco 500ie

    traction of the previous key). Leave it in this position for 1 to 3 seconds and return it to the « OFF » position. CORRECT PROGRAMMING CHECK PHASE Insert the «MASTER» key, disabling the transponder (i.e., by tilting the key cap by 90°), and turn the key to « ON » position. Perform the engine start-up operation. Ensure that the engine does no[…]

  • Page 22: Gilera Fuoco 500ie

    Remote control programming Follow these steps to program the remote controls: 1 . Insert the remote control key to be programmed in the steering lock key block. 2 . Turn the key to « ON », press the button on the remote control, release the button, turn the key back to « OFF » from the « ON » position, all within 4 seconds. 3 Wait 1 to 8 seco[…]

  • Page 23: Gilera Fuoco 500ie

    WARNING TO AVOID BATTERY DISCHARGE, THE SADDLE OPENING REMOTE CONTROL RADIO RECEIVER DEACTIVATES 7 DAYS AFTER THE LAST TIME THE VEHICLE WAS SHUT OFF. JUST TURN THE KEY TO «ON» TO REACTIVATE THE RECEIVER. 01_21 01_22 Accessing the fuel tank (01_21, 01_22) To open the fuel tank cover, set the key to « OFF » or « ON », then press and turn it clo[…]

  • Page 24: Gilera Fuoco 500ie

    01_23 Power supply socket (01_23) There is a plug socket » D » inside the helmet compartment. The plug socket may be used for external consumers (mobile phone, inspection light, etc.). CAUTION PROLONGED USE OF THE PLUG SOCKET MAY RESULT IN PARTIAL DIS- CHARGE OF THE BATTERY Electric characteristic Plug socket 12 V — 180 W MAX 01_24 The sa[. ..]

  • Page 25: Gilera Fuoco 500ie

    01_25 01_26 01_27 WARNING OBJECTS INAPPROPRIATELY ARRANGED INSIDE THE HELMET COMPART- MENT MAY DEFORM THE SADDLE CAUSING THE COURTESY LIGHT TO RE- MAIN ON AND THIS WILL DISCHARGE THE BATTERY. IN ANY CASE, THE WARNING LIGHT «I» ON THE INSTRUMENT PANEL SIGNALS IF THE LIGHT IS ON OR OFF. WARNING THE REMOTE CONTROL OPERATES WITHIN A DISTANCE […]

  • Page 26: Gilera Fuoco 500ie

    01_28 01_29 Identification (01_28, 01_29) Identification registration numbers are made up of a prefix and a number stamped on the chassis and on the engine. These numbers must always be quoted when ordering spare parts. We recommend checking that the chassis registration number stamped on the vehicle corresponds with that on the vehicle documentati[. ..]

  • Page 27: Gilera Fuoco 500ie

    Fuoco 500ie Chap. 02 Use 27[…]

  • Page 28: Gilera Fuoco 500ie

    Checks Before using the vehicle, check: 1 . There is enough fuel in the fuel tank. 2 . The correct fluid level for front and rear brakes. 3 . That tyres are properly inflated. 4 . The correct functioning of tail lights, headlamp, turn indicators, stop light and license plate light. 5 . The correct functioning of front and rear brakes. 6 . The oil l[…]

  • Page 29: Gilera Fuoco 500ie

    02_02 CAUTION PETROL DAMAGES THE PLASTIC PARTS OF THE BODYWORK. WARNING DO NOT RIDE WITH THE FUEL TANK ALMOST EMPTY, LACK OF FUEL CAN DAMAGE THE CATALYTIC CONVERTER. CAUTION USING NON-RECOMMENDED PETROL REDUCES THE EFFICIENCY OF THE EXHAUST AND FUEL SUPPLY SYSTEMS. CAUTION DO NOT USE THE VEHICLE TO THE COMPLETE EXHAUSTION OF THE FUEL; IN THE EVENT […]

  • Page 30: Gilera Fuoco 500ie

    CAUTION USING OILS OTHER THAN THOSE RECOMMENDED CAN SHORTEN THE LIFE OF THE ENGINE. Characteristic Fuel tank (reserve) ~ 12 l (~2 l) 02_03 Tyre pressure (02_03) Check the tyre pressure and wear periodically (roughly every 500 km). Tyres feature wear indicators; replace tyres as soon as these indicators become visible on the tyre tread. Also check t[…]

  • Page 31: Gilera Fuoco 500ie

    Rear tyre Tubeless 140/70 — 14″ 68S or 68P reinf TYRE INFLATION PRESSURE Front tyre pressure (with passenger) 1.6 bar (1.8 bar) Rear tyre pressure (with passenger) 2. 4 bar (2.6 bar) 02_04 02_05 Shock absorbers adjustment (02_04, 02_05) The preloading of the springs can be adjusted to 4 positions using the ring nut located in the lower part of […]

  • Page 32: Gilera Fuoco 500ie

    WARNING WE RECOMMEND WEARING GLOVES WHILE CARRYING OUT THIS OPERA- TION IN ORDER TO AVOID INJURIES. WARNING WE STRONGLY RECOMMEND NOT TO ADJUST BOTH SHOCK ABSORBERS WITH DIFFERENT PRELOADING Running in DURING THE FIRST 1000 KM DO NOT RIDE THE VEHICLE OVER 80% OF ITS MAX. SPEED. AVOID OPENING THE THROTTLE GRIP COMPLETELY OR KEEP- ING A CONSTANT SPEE[…]

  • Page 33: Gilera Fuoco 500ie

    02_06 02_07 02_08 Starting up the engine (02_06, 02_07, 02_08) The vehicle is supplied with an ignition cut-off system, activated by the emergency cut-off switch. The engine cannot be started if the ignition cut-off switch is in the OFF position A running engine automatically switches off when the ignition cut-off switch is set to OFF . The vehicle[…]

  • Page 34: Gilera Fuoco 500ie

    CAUTION DO NOT START-UP THE ENGINE IN CLOSED AREAS BECAUSE EXHAUST GASES ARE TOXIC. CAUTION DUE TO THE HIGH TEMPERATURES THE CATALYTIC CONVERTER CAN REACH, ALWAYS TAKE CARE, WHEN PARKING THE SCOOTER, THAT THE EXHAUST DOES NOT COME INTO CONTACT WITH FLAMMABLE MATERIALS, TO AVOID SERIOUS BURNS. CAUTION DO NOT SWITCH OFF THE ENGINE WHILE THE VEHICLE I[…]

  • Page 35: Gilera Fuoco 500ie

    WARNING NEVER TRY TO START-UP THE ENGINE WITH THE THROTTLE GRIP TWISTED. THIS MAY LEAD TO LOSING CONTROL OF THE VEHICLE AND TO ROLLOVER, WITH CONSEQUENT SERIOUS OR, IN SOME CASES, LETHAL INJURIES. Precautions CAUTION NEVER STRESS THE ENGINE AT LOW TEMPERATURES IN ORDER TO AVOID POSSIBLE DAMAGE. BE CAREFUL NEVER TO EXCEED THE MAXIMUM SPEED WHILE RUN[…]

  • Page 36: Gilera Fuoco 500ie

    02_09 Stopping the engine (02_09) Fully untwist the throttle grip, then rotate the key in the switch « A » to « KEY OFF » (extractable key). CAUTION DUE TO THE HIGH TEMPERATURES THE CATALYTIC CONVERTER CAN REACH, ALWAYS TAKE CARE, WHEN PARKING THE SCOOTER, THAT THE EXHAUST DOES NOT COME INTO CONTACT WITH FLAMMABLE MATERIALS, TO AVOID SERIOUS BU[…]

  • Page 37: Gilera Fuoco 500ie

    02_11 Stand (02_11) Push with your foot on the centre stand’s fork » F » while lifting the vehicle backward, holding onto the handlebar. Automatic transmission To ensure simple, pleasurable riding, the vehicle is equipped with automatic trans- mission with regulator and centrifugal clutch. The system is designed to provide the best p[…]

  • Page 38: Gilera Fuoco 500ie

    of safe riding. We recommend practising riding in traffic-free zones, in order to acquire a good knowledge of your vehicle. 1 . Before riding off, remember to put on your helmet and fasten it correctly. 2. Reduce speed on rough roads and drive with care. 3. After riding on a long stretch of wet road without using the brakes, braking can be poor at […]

  • Page 39: Gilera Fuoco 500ie

    WARNING NEVER RIDE THE VEHICLE WITH ADDED ACCESSORIES (CASE AND/OR WINDSHIELD) FASTER THAN 120 KM/H. WITHOUT THESE ACCESSORIES THE VEHICLE MAY BE DRIVEN AT A HIGHER SPEED WITHIN THE LEGAL LIMITS. IF THERE ARE NOT-PIAGGO ACCESSORIES FITTED, OR AN ABNORMAL LOAD, OR IF THE VEHICLE IS NOT IN A GENERALLY GOOD CONDITION, OR WHEN- EVER WEATHER CONDITIONS [. ..]

  • Page 40: Gilera Fuoco 500ie

    02_12 02_13 02_14 Front suspension locking system (02_12, 02_13, 02_14, 02_15, 02_16, 02_17) The front suspension locking system simply prevents vehicle tilting when the « Q » switch is pressed. The warning light « E » starts flashing when the key switch is set to « ON ». This means that the system is enabled for locking activation. When the […]

  • Page 41: Gilera Fuoco 500ie

    02_15 02_16 02_17 CAUTION THE RIDER DETECTION SENSOR IS LOCATED IN THE FRONT PART OF THE SADDLE. AVOID PLACING BAGS OR HEAVY OBJECTS ACCIDENTALLY ON THE SADDLE. NOT OBSERVING THIS RULE MAY MOVE THE VEHICLE FORWARD AND RE- LEASE THE SUSPENSION LOCKING SYSTEM EVEN IF THE RIDER IS NOT SEATED, BY SIMPLY TWISTING THE THROTTLE. THE VEHICLE COULD FALL ACC[. ..]

  • Page 42: Gilera Fuoco 500ie

    WARNING IF THE RIDER IS NOT SEATED ON THE SADDLE WHILE THE VEHICLE IS IN MOTION AND THE LOCKING SYSTEM IS ENGAGED, AVOID OPERATING THE THROTTLE CONTROL PURPOSELESSLY AS THIS MAY DAMAGE THE CATA- LYTIC CONVERTER. CAUTION DO NOT RIDE DOWNHILL WITH THE SUSPENSION LOCKING SYSTEM ENGAG- ED AND THE KEY SWITCH SET TO OFF. With the vehicle off and the susp[…]

  • Page 43: Gilera Fuoco 500ie

    THAT THE POTENTIAL MOVEMENT CAUSED BY THE SLOPE TAKES THAT WHEEL AGAINST THE SIDEWALK. WITH THE STEERING LOCK ENGAGED, MANOEUVRE SO THAT THE SIDEWALK IS TO THE RIGHT WHEN YOUR VEHI- CLE IS PARKED UPHILL AND TO THE LEFT WHEN PARKED DOWNHILL. If the WARNING light « C » turns on (flashes), it means that there is a failure in the front suspension loc[. ..]

  • Page 44: Gilera Fuoco 500ie

    44 2 Use[…]

  • Page 45: Gilera Fuoco 500ie

    Fuoco 500ie Chap. 03 Maintenance 45[…]

  • Page 46: Gilera Fuoco 500ie

    03_01 03_02 03_03 Engine oil level In 4T engines, engine oil is used to lubricate the distribution elements, main bearings and thermal group. An insufficient quantity of oil can cause serious damage to the engine itself. In all four-stroke engines, a loss of efficiency in oil performance and consumption should be considered normal. Consumption can […]

  • Page 47: Gilera Fuoco 500ie

    03_04 necessary to check the oil level and top it up if required. If after having topped- up the oil, the warning light still comes on while braking, at idle speed or while turning a corner, it will be necessary to take your vehicle to an Authorised Serv- ice Centre. Engine oil change (03_03, 03_04) The oil and the filter must be changed as indicat[…]

  • Page 48: Gilera Fuoco 500ie

    Recommended products AGIP CITY HI TEC 4T Engine oil SAE 5W-40, API SL, ACEA A3, JASO MA Synthetic oil 03_05 03_06 Hub oil level (03_05, 03_06) Check the oil in the rear hub. (oil content ~ 250 cc). To check the rear hub oil level, proceed as follows: 1) Rest the vehicle onto its centre stand, on level ground. 2) Unscrew the dipstick « A », dry it[…]

  • Page 49: Gilera Fuoco 500ie

    CAUTION AN EXCESSIVE QUANTITY OF OIL CAN LEAD TO LEAKAGE, WHICH MAY CAUSE THE ENGINE AND THE WHEEL TO GET DIRTY. CAUTION WHEN REPLACING THE HUB OIL DO NOT LET THE OIL COME INTO CONTACT WITH THE REAR BRAKE DISC. CAUTION FOR OIL REPLACEMENT, CONTACT ANY AUTHORISED SERVICE CENTRE AS THEY ARE EQUIPPED TO DISPOSE OF USED OILS IN AN ENVIRONMENTALLY FRIEN[…]

  • Page 50: Gilera Fuoco 500ie

    03_07 Tyres (03_07) Check the tyre pressure and wear periodically (roughly every 500 km). Tyres feature wear indicators; replace tyres as soon as these indicators become visible on the tyre tread. Also check that the tyres do not show signs of splitting at the side or irregular tread wear; if this occurs, go to an authorised workshop or at least to[…]

  • Page 51: Gilera Fuoco 500ie

    TYRE INFLATION PRESSURE Front tyre pressure (with passenger) 1.6 bar (1.8 bar) Rear tyre pressure (with passenger) 2. 4 bar (2.6 bar) 03_08 03_09 Spark plug dismantlement (03_08, 03_09) This engine has two spark plugs. Remove the port on the left-hand side panel of the vehicle by undoing the fixing screw « A » and using a small screwdriver in the […]

  • Page 52: Gilera Fuoco 500ie

    N.B. THE USE OF SPARK PLUGS OTHER THAN THE INDICATED TYPE OR OF SHIELDLESS SPARK PLUG CAPS CAN CAUSE ELECTRICAL SYSTEM FAIL- URES. Characteristic Spark plug NGK CR7EKB Electrode gap 0.7 ÷ 0.9 mm 03_10 Removing the air filter (03_10) Proceed as follows: Unscrew the nine fixing screws « A » and remove the air filter cover « B ». Air filter clean[…]

  • Page 53: Gilera Fuoco 500ie

    CAUTION IF THE VEHICLE IS USED ON DUSTY ROADS IT IS NECESSARY TO CARRY OUT MAINTENANCE CONTROLS OF THE AIR FILTER TO AVOID DAMAGING THE ENGINE. Recommended products AGIP FILTER OIL Oil for air filter sponge Mineral oil with specific additives for increased adhesiveness 03_11 03_12 Cooling fluid level (03_11, 03_12, 03_13, 03_14) The engine cooling […]

  • Page 54: Gilera Fuoco 500ie

    03_13 03_14 If it is necessary to top up the coolant frequently, or if the expansion tank is completely dry, you should look for the cause in the cooling system. It is therefore essential to have the cooling system checked at an Authorised Service Centre . Replace coolant as indicated in the scheduled maintenance table. Take your vehicle to an Auth[…]

  • Page 55: Gilera Fuoco 500ie

    Recommended products SPECIAL AGIP PERMANENT fluid coolant Monoethylene glycol-based antifreeze fluid, CUNA NC 956-16 03_15 03_16 Checking the brake oil level (03_15) The front and rear brake fluid reservoirs are both positioned on the handlebars. Pro- ceed as follows: 1 . Place the scooter on its centre stand and make sure the handlebar is centred;[…]

  • Page 56: Gilera Fuoco 500ie

    WARNING ONLY USE DOT 4 CLASS BRAKE FLUIDS. COOLING SYSTEM FLUIDS ARE HIGHLY CORROSIVE. MAKE SURE THAT IT DOES NOT COME INTO CONTACT WITH THE PAINTWORK . CAUTION AVOID CONTACT OF BRAKE FLUID WITH EYES, SKIN, AND CLOTHING. IN CASE OF CONTACT, RINSE WITH WATER. THE BRAKING CIRCUIT FLUID IS HYGROSCOPIC, THAT IS, IT ABSORBS HUMIDITY FROM THE SURROUNDING[…]

  • Page 57: Gilera Fuoco 500ie

    03_17 03_18 Battery (03_17) To access the battery, proceed as follows: 1. Place the scooter on its centre stand; 2. Open the saddle, following the previously described procedure; 3. Remove the two fasteners » A » and the cover » B «. WARNING IN ORDER TO AVOID DAMAGING THE ELECTRICAL SYSTEM, NEVER DISCON- NECT THE WIRING WHILE TH[…]

  • Page 58: Gilera Fuoco 500ie

    Long periods of inactivity If the vehicle has not been used for long periods, it is necessary to periodically re- charge the battery, bearing in mind that the battery tends to go completely flat within around three months. The battery must be recharged with a current load equal to 1/10 of the battery rated capacity (~ 1A ), for a period not longer […]

  • Page 59: Gilera Fuoco 500ie

    03_21 03_22 03_23 59 3 Maintenance[…]

  • Page 60: Gilera Fuoco 500ie

    FUSE TABLE Fuse No. 1 Capacity: 7.5 A Protected circuits: Injection ECU battery power Fuse No. 2 Capacity: 15 A Protected circuits: Battery- powered injection loads, electrical fan Fuse No. 3 Capacity: 15 A Protected circuits: Battery- powered saddle opening switch, glove-box lighting, light switch, turn indicator switch, antitheft installation, fu[…]

  • Page 61: Gilera Fuoco 500ie

    Protected circuits: Battery- powered instrument panel Fuse No. 8 Capacity: 10A Protected circuits: Live stop, start-up and start-up enabling switch and start-up circuit. Fuse No. 9 Capacity: 7.5 A Protected circuits: live passing and horn Fuse No. 10 Capacity: 7.5A Protected circuits: Live injection ECU, immobilizer aerial, electric fan remote cont[…]

  • Page 62: Gilera Fuoco 500ie

    L IGHT BULBS TABLE Low-beam bulb Type: HALOGEN (H8) Power: 12V — 35W Quantity: 1 RHS + 1 LHS High-beam light bulb Type: HALOGEN (H8) Power: 12V — 35W Quantity: 1 RHS + 1 LHS Helmet compartment light bulb Type: FESTOON BULB Power: 12V — 5W Quantity: 1 Rear turn indicator light bulb Type: WITH BULB Power: 12V — 10W Quantity: 1 RHS + 1 LHS Rear tail l[. ..]

  • Page 63: Gilera Fuoco 500ie

    Power: 12V — 5W Quantity: 1 Front turn indicator bulb Type: WITH BULB Power: 12V — 10W Quantity: 1 RHS + 1 LHS Front tail light bulb Type: ALL GLASS Power: 12V — 5W Quantity: 1 Instrument panel bulb Type: ALL GLASS Power: 12V — 2W Quantity: 4 03_24 Front light group (03_24, 03_25, 03_26, 03_27, 03_28, 03_29) To access the tail light bulb: — Insert […]

  • Page 64: Gilera Fuoco 500ie

    03_25 03_26 03_27 To replace it, disconnect the connector and insert a new bulb WARNING HIGH AND LOW BEAM LIGHT ARE OF THE HALOGEN TYPE: DO NOT TOUCH WITH YOUR FINGERS TO AVOID DAMAGING THEIR FUNCTION. Headlight adjustment (03_30, 03_31, 03_32, 03_33, 03_34) Proceed as follows: — Position the unloaded vehicle, in running order and with the tyres in[. ..]

  • Page 65: Gilera Fuoco 500ie

    03_28 03_29 03_30 do that, remove the connector from the other bulbs so that you can adjust one head- lamp at a time. N.B. THE HEADLAMPS CAN ONLY BE LIT WHEN THE ENGINE IS ON. ADJUST THE LIGHT BEAM IN A WELL VENTILATED PLACE. 65 3 Maintenance[…]

  • Page 66: Gilera Fuoco 500ie

    03_31 03_32 03_33 66 3 Maintenance[…]

  • Page 67: Gilera Fuoco 500ie

    03_34 03_35 Front direction indicators (03_35) To access the bulb, undo the screw « A » and remove the glass « B ». To replace the bulb, hold it and then turn it clockwise. 67 3 Maintenance[…]

  • Page 68: Gilera Fuoco 500ie

    03_36 03_37 Rear optical unit (03_36, 03_37) To access the rear light unit bulbs, undo the screw « A » and remove the glass « B ». Now tighten the screw « A » in its seat. To replace the stop light bulb « C », hold it and turn it anticlockwise. To replace the rear tail light bulb « D », hold it and pull it outwards. 03_38 Rear turn indica[…]

  • Page 69: Gilera Fuoco 500ie

    03_39 Number plate light (03_39) Remove the screw « C », then take out the bulb holder. 03_40 Helmet compartment lighting bulb (03_40) Open the rear boot and insert a small plain slot screwdriver in the lateral notch to detach the snap-on glass » D «, then replace the bulb. 03_41 Rear-view mirrors (03_41) The mirrors can be set to the d[…]

  • Page 70: Gilera Fuoco 500ie

    Front and rear disc brake The brake disc and pad wear is automatically compensated, therefore it has no effect on the functioning of the front and rear brakes. For this reason it is not necessary to adjust the brakes. An excessively elastic brake lever stroke may indicate the presence of air in the braking circuit or a failure in the braking system[…]

  • Page 71: Gilera Fuoco 500ie

    ORDER TO AVOID THIS, WE RECOMMEND WASHING THE VEHICLE FRE- QUENTLY WHEN RIDING IN THESE ROAD CONDITIONS. Puncture The vehicle is equipped with tubeless tyres (without inner tube). In the event of a puncture, contrary to the situation with a tyre with inner tube, the tyre deflates more slowly, resulting in a greater steering safety. In the event of […]

  • Page 72: Gilera Fuoco 500ie

    2 . Be careful to rest the vehicle on its centre stand disabling the front suspension locking system; 3. With engine off and piston at the bottom dead centre, remove the spark plug, add 1÷2 cc of oil through the opening (adding more oil may damage the engine). Operate the starter button 1-2 times for roughly 1 second to turn the engine over slowly[…]

  • Page 73: Gilera Fuoco 500ie

    CAUTION PER IL LAVAGGIO DEL MOTORE E DEL VEICOLO É SCONSIGLIATO L’UTILIZ- ZO DELL’IDROPULITRICE; NEL CASO CHE NON SIA POSSIBILE EFFETTUARE TALE OPERAZIONE IN UN ALTRO MODO, É NECESSARIO: • USARE SOLAMENTE IL GETTO A VENTAGLIO. • NON AVVICINARE LA LANCIA A MENO DI 2 FT (60 CM). • NON USARE ACQUA A TEMPERATURE SUPERIORI A 100° F (4[…]

  • Page 74: Gilera Fuoco 500ie

    STARTING FAILURE Emergency switch in «OFF» Set the switch back to « ON » Fuse blown Replace the blown fuse and have the vehicle checked by an Authorised Service Centre. IGNITION PROBLEM Faulty spark plug Contact an Authorised Service Centre. Faulty ignition / injection control unit. Contact an Authorised Service Centre. Faulty coil. Due to the […]

  • Page 75: Gilera Fuoco 500ie

    HIGH CONSUMPTION AND LOW PERFORMANCE Air filter blocked or dirty. Clean with water and shampoo and impregnate with petrol and specific oil (section «Removing the air filter») INSUFFICIENT BRAKING Greasy disc. Worn pads. Faulty braking system. Presence of air in the front and rear brake circuit. Contact an Authorised Service Centre. INEFFICIENT SU[…]

  • Page 76: Gilera Fuoco 500ie

    76 3 Maintenance[…]

  • Page 77: Gilera Fuoco 500ie

    Fuoco 500ie Chap. 04 Technical data 77[…]

  • Page 78: Gilera Fuoco 500ie

    04_01 78 4 Technical data[. ..]

  • Page 79: Gilera Fuoco 500ie

    ENGINE TECHNICAL DATA Type Single-cylinder, 4-stroke Cubic capacity 493 cm³ Bore x Stroke 94 x 71 mm Compression ratio 10.5 ± 0.5 : 1 Engine idle speed 1,500 ± 100 rpm Timing system Four valves, single overhead camshaft, chain driven. Valve clearance Inlet: 0.15 mm Outlet: 0.15 mm MAX. power 29.5 kW at 7,250 rpm MAX Power for crossover version 2[…]

  • Page 80: Gilera Fuoco 500ie

    Ignition Highly efficient electronic inductive ignition, integrated with the injection system, with variable advance, separate HV coil and double spark plug. Ignition advance Three-dimensional map managed by control unit Spark plug NGK CR7EKB Alternative spark plug — Fuel supply Electronic injection with electric fuel pump. Fuel Unleaded petrol (95[. ..]

  • Page 81: Gilera Fuoco 500ie

    Front brake Ø 240 mm double disk with hydraulic control activated by the handlebar right-hand lever. Rear brake disc brake, diameter 240 mm, with hydraulic servo operated from the handlebar with the left-hand lever. Wheel rim type Light alloy rims. Front rim 12» x 3.00 Rear rim 14» x 4.50 Front tyre Tubeless 120/70-12″ 5[…]

  • Page 82: Gilera Fuoco 500ie

    04_02 Kit equipment (04_02) The toolkit comprises: — One box-spanner. — One twin screwdriver — One special spanner for adjusting the rear shock absorbers — One plastic clip for removing the fuses. The tools are stored in the helmet compartment. 82 4 Technical data[…]

  • Page 83: Gilera Fuoco 500ie

    Fuoco 500ie Chap. 05 Spare parts and accessories 83[…]

  • Page 84: Gilera Fuoco 500ie

    05_01 Warnings (05_01) WARNING TO PREVENT ACCIDENTS AND TO GUARANTEE PROPER STABILITY, PER- FORMANCE AND SAFETY, RIDE THE VEHICLE VERY CAREFULLY WHEN IT IS FITTED WITH ACCESSORIES OR WITH UNUSUAL LOADS. WARNING IT IS ALSO RECOMMENDED THAT «ORIGINAL PIAGGIO SPARE PARTS» BE USED, AS THESE ARE THE ONLY ONES OFFERING YOU THE SAME QUALITY GUAR[…]

  • Page 85: Gilera Fuoco 500ie

    THERE ARE NOT-PIAGGO ACCESSORIES FITTED, OR AN ABNORMAL LOAD, OR IF THE VEHICLE IS NOT IN A GENERALLY GOOD CONDITION, OR WHEN- EVER WEATHER CONDITIONS DEMAND IT, SPEED SHOULD BE FURTHER REDUCED. WARNING BE EXTREMELY CAREFUL WHEN INSTALLING AND REMOVING THE MECHAN- ICAL ANTITHEFT DEVICE ON THE VEHICLE (U-SHAPED PADLOCK, DISC BLOCK, ETC. ). MAINLY DUE[…]

  • Page 86: Gilera Fuoco 500ie

    86 5 Spare parts and accessories[…]

  • Page 87: Gilera Fuoco 500ie

    Fuoco 500ie Chap. 06 Programmed maintenance 87[…]

  • Page 88: Gilera Fuoco 500ie

    Scheduled maintenance table Adequate maintenance is fundamental to ensuring long-lasting, optimum operation and performance of your vehicle. To this end, a series of checks and maintenance operations (at the owner’s expense) have been suggested, which are included in the summary table on the following page. Any minor faults should be reported […]

  • Page 89: Gilera Fuoco 500ie

    Engine oil — replacement Brake pads — check condition and wear Tyre pressure and wear — check Vehicle and brake test — road test Hub oil — change Steering — Check Parking control unit software upgrading (if available) AFTER 5,000 KM; 25,000 KM; 35,000 KM; 55,000 KM; 65,000 KM Engine oil — level check/ top-up Brake pads — check condition and wear Ce[. ..]

  • Page 90: Gilera Fuoco 500ie

    Coolant level — check Brake fluid level — check Engine oil — replacement Brake pads — check condition and wear Sliding block / variable speed rollers — change Tyre pressure and wear — check Vehicle and brake test — road test Hub oil — check Suspensions — check Steering — Check Centre stand — lubrication Spark plugs — replacement Tilt locking grippe[…]

  • Page 91: Gilera Fuoco 500ie

    AFTER 20,000 KM; 40,000 KM; 60,000 KM AND 80,000 KM Spark plugs — replacement Driving belt — replacement Throttle lever — adjustment Air filter — check Engine oil — change Valve clearance — check Electrical system and battery — check Coolant level — check Engine oil — replacement Brake pads — check condition and wear Sliding block / variable speed [. ..]

  • Page 92: Gilera Fuoco 500ie

    30,000 KM Safety locks — check Driving Belt — replacement Throttle lever — adjustment Air filter — clean Engine oil — change Electrical system and battery — check Coolant level — check Brake fluid level — check Engine oil — replacement Hub oil — check Brake pads — check condition and wear Sliding block / variable speed rollers — change Tyre pressur[…]

  • Page 93: Gilera Fuoco 500ie

    RECOMMENDED PRODUCTS TABLE Product Description Specifications AGIP ROTRA 80W-90 Rear hub oil SAE 80W/90 Oil that exceeds the requirements of API GL3 specifications AGIP GP 330 Grease for brake control levers, throttle, stand White calcium complex soap-based spray grease with NLGI 2; ISO-L-XBCIB2 AGIP CITY HI TEC 4T Oil to lubricate flexible transmi[. ..]

  • Page 94: Gilera Fuoco 500ie

    94 6 Programmed maintenance[…]

  • Page 95: Gilera Fuoco 500ie

    TABLE OF CONTENTS A Air filter: 52 B Battery: 57 Brake: 55 , 70 C Clock: 12 D Disc brake: 70 Display: 12 E Engine oil: 46 , 47 Engine stop: 17 F Fuel: 23 Fuses: 58 H Headlight: 64 Horn: 16 Hub oil: 48 I Identification: 26 Immobilizer: 18 , 20 Instrument panel: 11 K Key switch: 14 Keys: 18 L Light switch: 16 M Maintenance: 13 , 45 , 87 , 88 Mirrors:[…]

  • Page 96: Gilera Fuoco 500ie

    The descriptions and illustrations given in this publication are not binding. While the basic features as described and illustrated in this manual remain unchanged, PIAGGIO — GILERA reserves the right, at any time and without being required to update this publication beforehand, to make any changes to components, parts or accessory supplies, which [. ..]

  • Gilera Fuoco 500ie: скутерный трипл-дабл, или дьявольский «Гномик» наоборот

    Скутер с тремя колесами все равно что белая ворона, разноцветный голубь или девушка с тремя грудями. А, когда два колеса еще и спереди, а не сзади, это равносильно едущему задним ходом велосипеду «Гномик», или того хуже, девушке с тремя грудями и двумя ртами. Мы к тому, что это вовсе не плохо, а просто непривычно! Зато очень практично… не так ли?

    Поскольку опыта вождения подобной техникой мы не имеем, рассказать о трипл-дабле мы попросили самого владельца Gilera Fuoco 500ie – нашего друга, читателя и по совместительству писателя.

    (англ. triple-double — баскетбольный термин, говорящий о наборе игроком в трёх показателях более 10 пунктов). Этот мотороллер стал настоящей революцией в мире мототехники. Хотя подобные конструкции воплощались в жЫзнь и раньше, но до массового производства дело дошло только сейчас. Трехколесники концерна Piaggio (куда с 1960 года входит и Gilera) поделены на две категории: первая – модели Piaggio MP3 с объемом двигателя от 125 до 400 см3 – городские скутеры с привлекательным дизайном, рассчитанные на широкий круг потребителей; и вторая – Gilera Fuoco 500ie (в США продается под именем Piaggio MP3 500) – мотороллер с агрессивной внешностью, которая придется по вкусу далеко не всем.  В сегодняшнем обзоре главным героем выступит более неординарная модификация.

    Увидев дьявольский (оф.название цвета – Demon Black) скутер впервые, я не придал ему особого значения. Ну да, необычная конструкция, странный дизайн, но что-то просто не зацепило. И лишь став обладателем зверя, я понял, что его внешность (скутера, не хозяина! – прим.ред) или приковывает взгляд и заставляет восхищаться, либо пугает и вызывает негативные эмоции.  Равнодушным к нему не остается никто. Кому-то передок напоминает злобное насекомое, другие же не перестают находить ассоциации с космическим кораблем эпохи Звездных Войн. Даже после полутора лет активного использования мотороллера в городе, челюсти прохожЫх по-прежнему лежат в области ног, глаза все так же выпучены в изумлении, а руки так и тянутся пощупать сие чудо дизайна и техники. Но оставив Фуоку на тротуаре хотя бы на час-два, существует стопроцентная гарантия увидеть следы «посиделок» самых отважных пешеходов.

    После «морды лица» следует привычная в техническом плане хвостовая часть. Силовая установка и трансмиссия – типичный 500-кубовый макси от Piaggio, что позволяет превосходно чувствовать себя как в городской среде, так и в загородных поездках. Динамика конечно не удивит поклонников двух колес – 7,5 секунд до 100 км/ч по меркам современного мотостроения – просто вечность, но райдеру без особых спортивных амбиций подойдет, тем более, что вариатор позволяет двигателю довольно быстро набирать обороты.

    Конструкция передней подвески довольно сложна, чем и интересна. Не вдаваясь в техническую терминологию, расскажу лишь о режЫмах работы гидравлической системы передних колес. Вообще-то их всего два – заблокированный и свободный. Фишка именно в переключении между ними. Кто читал зарубежные тесты данного аппарата, могут вспомнить про автоматический режим, когда подвеска блокируется самостоятельно при скорости менее 10 км/ч… так вот – «цэ всьо туфта», как говорит одна моя знакомая, такого режЫма нет. В первый режЫм возможно перейти лишь мануально – с помощью переключателя на правой рукоятке при условии, что скорость движения будет до 15 км/ч, а обороты коленвала не будут превышать отметку в 2 500 об/мин. НаловчившЫсь, это можно осуществлять на ходу, во время остановки на светофоре, например. Также конструкция позволяет заблокировать подвеску в наклоненном положении скутера. Перейти во второй режим можно с помощью того же переключателя, или просто открыв дроссель. В свободном режЫме Фуока ведет себя как обычный максискутер, иногда лишь давая знать о своей немаленькой массе в 250 кг. К слову, трехколесный агрегат можно уронить – было бы желание, или неумение.

    Приборная панель выглядит довольно современно и напоминает таковую в автомобилях или туристических мотоциклах. Два «колодца» спидометра  и тахометра разделены многофункциональным дисплеем, на который выводится информация о температуре охлаждающей жидкости, одометре, двух трипметрах и температуре «за бортом». Показатель уровня топлива расположЫлся в нижней части тахометра. Большое количество лампочек и индикаторов намекают на высокий технический уровень мотороллера.

    Посадка типично скутерная, только в дальних поездках хотелось бы большего пространства для ног, которое ограничено передней подвеской. Сиденье удобное и достаточно широкое. В нем находится датчик присутствия пилота. Он защищает скутер и всех вокруг от такого бездумного действия, как пытаться «погазовать» на месте. В ситуации без датчика, агрегат просто уезжает «в зокад» самостоятельно, Фуока же гасит обороты двигателя, не пытаясь двинуться с места. Под сидением находится багажное отделение, способное вместить шлем-интеграл и еще немного мелочевки. В подседельном пространстве радует наличие подсветки и розетки на 12В. Стандартный ветровой щиток абсолютно не спасает от воздушных потоков. К счастью, установить тюнинговый не составляет проблем.

    Тормозная система заслужЫвает отдельного внимания. На всех колесах установлены 240мм тормозные диски в паре с однопоршневыми передними и двухпоршневым задним суппортом. Также в стоке устанавливаются армированные тормозные шланги. Но фишка, опять же, в стабильности аппарата при торможении. Можно доводить до блокировки как заднего, так и всех колес, сохраняя вертикальное положение. Еще один большой плюс к безопасности пилота.

    Вся сущность аппарата раскрывается в удобстве пользования в городском пространстве. На нем перестаешь замечать скользкую разметку, грязь на дороге, переезжать рельсы под любым удобным углом, уверенно двигаться по мокрой брусчатке и много прочих приятных моментов.  Ширина Фуоки позволяет свободно лавировать в потоке четырех колесных как на обычном максискутере. Также хочется упомянуть о простоте парковки – останавливаешься там, где удобно, фиксируешь переднюю подвеску в вертикальном положении, затягиваешь ручник, блокируешь руль и все. Скутер надежно стоит даже под уклоном. Если намечается дождь, можно воспользоваться встроенным чехлом для сиденья.

    P.S. Если вы, читая этот обзор, не нашли ответов на свои главные вопросы «Скільки жре-пре-стоїть», успокою ваши души исчерпывающими ответами:

    Расход топлива от 4 (загородное шоссе) до 5,5-6 литров на 100 км в условиях агрессивных ускорений с неистовым «масланием» ручки акселератора.
    Максимальная скорость находится в районе 160 км/ч, комфортная крейсерская – 120-130 км/ч. http://rusaktiv.ru/ekipirovka-dlya-mototsiklov/muzhskaya-ekipirovka/kross/bryuki

    Цена? Около $9 000. Но надо чОтко понимать, что мотоцикл, конечно же, круче даже такого скутера, но об этом перестаешь думать, когда понимаешь, что на каком-либо двухколеснике уже давно бы «разложЫлся»…

    Текст: Slevin
    ФОТО: ПапараццЫ

    ТЖ

    FA260HH EBC BRAKES Double-H™ тормозные колодки DERBI Sonar; GILERA Fuoco; PIAGGIO 125, 300, Liberty, MP3, MP4, Zip; VESPA ET, LX, LXV, S

    Колодка подходит для мотоциклов:
    2009-2010 DERBI Sonar 150(4T)
    2010-2011 DERBI Sonar 50 (2T)
    2010-2011 DERBI Sonar 125 (4T)
    2009-2010 DERBI Sonar 150(4T)
    2010-2011 DERBI Sonar 50 (2T)
    2010-2011 DERBI Sonar 125 (4T)
    2007-2012 GILERA Fuoco 500 RC/ie
    2011-2012 PIAGGIO 125 ie MP3 Yourban
    2011-2012 PIAGGIO 300 ie MP3 Yourban
    2011-2012 PIAGGIO 300 ie MP3 Yourban LT
    2011-2012 PIAGGIO 300 ie MP3 Yourban
    2011-2012 PIAGGIO 300 ie MP3 Yourban LT
    2008 PIAGGIO Liberty 150 (5 Spoke Wheels)
    2007-2008 PIAGGIO Liberty S 50 (2T)
    2007-2008 PIAGGIO Liberty S 50 (4T)
    2007-2008 PIAGGIO Liberty S 125
    2007-2008 PIAGGIO Liberty S 200
    2009-2012 PIAGGIO Liberty 125 (4T / 10 Spoke Cast Wheels)
    2009-2012 PIAGGIO Liberty 150 (4T / 10 Spoke Cast Wheels)
    2011-2012 PIAGGIO Liberty Elettrico
    2000-2008 PIAGGIO Liberty 50 4T (Grimeca Caliper 5 Spoke Wheels)
    2000-2008 PIAGGIO Liberty 50 4T (Heng Tong Caliper / 5 Spoke Wheels)
    1997-2008 PIAGGIO Liberty 50 (Grimeca Caliper) (2T/ 5 Spoke Wheels)
    1997-2008 PIAGGIO Liberty 50 (Heng Tong Caliper) (2T / 5 Spoke Wheels)
    1998-2007 PIAGGIO Liberty 200
    1998-2008 PIAGGIO Liberty 125 (5 Spoke Wheels)
    2008 PIAGGIO Liberty 150 (5 Spoke Wheels)
    2007-2008 PIAGGIO Liberty S 50 (2T)
    2007-2008 PIAGGIO Liberty S 50 (4T)
    2007-2008 PIAGGIO Liberty S 125
    2007-2008 PIAGGIO Liberty S 200
    2009-2012 PIAGGIO Liberty 125 (4T / 10 Spoke Cast Wheels)
    2009-2012 PIAGGIO Liberty 150 (4T / 10 Spoke Cast Wheels)
    2011-2012 PIAGGIO Liberty Elettrico
    2000-2008 PIAGGIO Liberty 50 4T (Grimeca Caliper 5 Spoke Wheels)
    2000-2008 PIAGGIO Liberty 50 4T (Heng Tong Caliper / 5 Spoke Wheels)
    1997-2008 PIAGGIO Liberty 50 (Grimeca Caliper) (2T/ 5 Spoke Wheels)
    1997-2008 PIAGGIO Liberty 50 (Heng Tong Caliper) (2T / 5 Spoke Wheels)
    1998-2007 PIAGGIO Liberty 200
    1998-2008 PIAGGIO Liberty 125 (5 Spoke Wheels)
    2007-2010 PIAGGIO MP3 400 ie
    2011-2012 PIAGGIO MP3 Touring 400 ie
    2011-2012 PIAGGIO MP3 Touring LT 400 ie
    2009 PIAGGIO MP3 LT 250 ie (14” rear wheel)
    2010 PIAGGIO MP3 LT 300 ie
    2008-2009 PIAGGIO MP3 250 MIC/EFI (14” rear wheel)
    2009-2010 PIAGGIO MP3 500 EFI
    2008-2011 PIAGGIO MP3 125 ie (EFI models) (14” rear wheel)
    2009-2012 PIAGGIO MP3 125 (Hybrid/125cc) (14” rear wheel)
    2011-2012 PIAGGIO MP3 Hybrid 300 ie
    2011-2012 PIAGGIO MP3 Hybrid LT 300 ie
    2011-2012 PIAGGIO MP3 Touring 300 ie
    2011-2012 PIAGGIO MP3 Touring LT 300 ie
    2011-2012 PIAGGIO MP3 Touring Business 500 ie
    2011-2012 PIAGGIO MP3 Touring Business LT 500 ie
    2011-2012 PIAGGIO MP3 Touring Sport 500 ie
    2011-2012 PIAGGIO MP3 Touring Sport LT 500 ie
    2006-2008 PIAGGIO MP3 125 (Carb models) (12” rear wheel)
    2006-2008 PIAGGIO MP3 250 EFI (12” rear wheel)
    2009 PIAGGIO MP3 LT 250 ie (14” rear wheel)
    2010 PIAGGIO MP3 LT 300 ie
    2006-2008 PIAGGIO MP3 125 (Carb models) (12” rear wheel)
    2006-2008 PIAGGIO MP3 250 EFI (12” rear wheel)
    2008-2009 PIAGGIO MP3 250 MIC/EFI (14” rear wheel)
    2007-2010 PIAGGIO MP3 400 ie
    2009-2010 PIAGGIO MP3 500 EFI
    2008-2011 PIAGGIO MP3 125 ie (EFI models) (14” rear wheel)
    2009-2012 PIAGGIO MP3 125 (Hybrid/125cc) (14” rear wheel)
    2011-2012 PIAGGIO MP3 Hybrid 300 ie
    2011-2012 PIAGGIO MP3 Hybrid LT 300 ie
    2011-2012 PIAGGIO MP3 Touring 300 ie
    2011-2012 PIAGGIO MP3 Touring LT 300 ie
    2011-2012 PIAGGIO MP3 Touring 400 ie
    2011-2012 PIAGGIO MP3 Touring LT 400 ie
    2011-2012 PIAGGIO MP3 Touring Business 500 ie
    2011-2012 PIAGGIO MP3 Touring Business LT 500 ie
    2011-2012 PIAGGIO MP3 Touring Sport 500 ie
    2011-2012 PIAGGIO MP3 Touring Sport LT 500 ie
    2009-2010 PIAGGIO MP3-LT 400 ie
    1996-1999 PIAGGIO Zip 50 RST
    2007 PIAGGIO Zip 100
    2000-2001 PIAGGIO Zip 125 (4T -200MM F/DISC)
    1996-1912 PIAGGIO Zip 50 SP (Liquid Cooled)
    2002-2004 PIAGGIO Zip 125 (4T -175MM F/DISC)
    2000-2009 PIAGGIO Zip 50 (Grimeca Caliper) (Heng Tong Caliper) (A/C) 4T
    2000-2012 PIAGGIO Zip 50 (2T)
    2000-2012 PIAGGIO Zip 50 (4T)
    2007 PIAGGIO Zip 100
    2002-2004 PIAGGIO Zip 125 (4T -175MM F/DISC)
    2000-2001 PIAGGIO Zip 125 (4T -200MM F/DISC)
    2000-2009 PIAGGIO Zip 50 (Grimeca Caliper) (Heng Tong Caliper) (A/C) 4T
    2000-2012 PIAGGIO Zip 50 (2T)
    2000-2012 PIAGGIO Zip 50 (4T)
    1996-1912 PIAGGIO Zip 50 SP (Liquid Cooled)
    1996-1999 PIAGGIO Zip 50 RST
    1997-2005 VESPA ET2 50
    2000-2004 VESPA ET4 50 (Grimeca Caliper)
    2000-2004 VESPA ET4 50 (Heng Tong Caliper)
    1996-1999 VESPA ET4 125
    1999-2005 VESPA ET4 125/150
    1997-2005 VESPA ET2 50
    2000-2004 VESPA ET4 50 (Grimeca Caliper)
    2000-2004 VESPA ET4 50 (Heng Tong Caliper)
    1996-1999 VESPA ET4 125
    1999-2005 VESPA ET4 125/150
    2012 VESPA LX 125 ( Serie Speciali /4T)
    2012 VESPA LX 150 ( Serie Speciali /4T)
    2005-2012 VESPA LX 50 (2T)
    2005-2012 VESPA LX 50 (4T/4V)
    2005-2012 VESPA LX 125 (4T)
    2005-2012 VESPA LX 150 (4T)
    2012 VESPA LX 125 ( Serie Speciali /4T)
    2012 VESPA LX 150 ( Serie Speciali /4T)
    2005-2012 VESPA LX 50 (2T)
    2005-2012 VESPA LX 50 (4T/4V)
    2005-2012 VESPA LX 125 (4T)
    2005-2012 VESPA LX 150 (4T)
    2007-2009 VESPA LXV 50
    2007-2012 VESPA LXV 125
    2007-2009 VESPA LXV 50
    2007-2012 VESPA LXV 125
    2007-2012 VESPA S 50 (2T)
    2007-2012 VESPA S 125 (4T)
    2007-2012 VESPA S 150 (4T)
    2008-2012 VESPA S 50 (4T/4V)
    2011-2012 VESPA S 50 Sport (2T)
    2011-2012 VESPA S 50 Sport (4T/4V)
    2011-2012 VESPA S 125 Sport (4T)
    2011-2012 VESPA S 150 Sport (4T)
    2007-2012 VESPA S 50 (2T)
    2007-2012 VESPA S 125 (4T)
    2007-2012 VESPA S 150 (4T)
    2008-2012 VESPA S 50 (4T/4V)
    2011-2012 VESPA S 50 Sport (2T)
    2011-2012 VESPA S 50 Sport (4T/4V)
    2011-2012 VESPA S 125 Sport (4T)
    2011-2012 VESPA S 150 Sport (4T)

    

    Double-H™ Sintered Superbike Brake Pads

    Тормозные колодки Double-H ™ Superbike обеспечивают высокую производительность и хорошо известны как флагманская линейка EBCstreetsport. Сертификат ECE R 90 безопасности и протестированы TUV — означают что, эти тормозные колодки с ультра высоким коэффициентом трения HH рейтингом остаются лидерами на рынке выше остальных конкурентов, как никто другой не сравнится производительность Double-H ™ Superbike тормозных колодок. Произведено в США в аглофабрики Огайо, Double-H ™ Superbike Тормозные колодки хорошо работают в любых погодных условиях, будь то сухой или влажной асфальт и имеют высокую долговечность, длящуюся в течение многих тысяч миль. Для гонки использовать мы рекомендуем рассмотреть колодки EPFA или GPFAX.

    • Колодка разработана и имеет допуски для использования на дорогах общего пользования
    • Дает совершенное торомжение на сухом и мокром покрытии
    • Длительный срок службы

    Для большинство производителей мотоциклов и скутеров эти колодки — прямая замена, но с улучшенными характеристиками и с несколькими различиями. Во-первых использованы наработки исключительно ЕВС, которые являются непревзойденными с точки зрения качества материалов и качества изготовления. Во-вторых почти все EBC Double-H ™ тормозные колодки EBC пластины на которые крепиться колодка, изготовлены из нержавеющей стали с перфорацией и противоскрипными экранами на обратной стороне.

    Gilera Fuoco 500 | 2016

    39

    главная передача:
    Общая информация
    Модель: Gilera Fuoco 500
    Год: 2016
    Категория: Скутер

    3.4 Посмотрите подробный рейтинг соотношения цены и качества, дизайна и внешнего вида, надежности и т. Д. Сравните с любым другим велосипедом.
    Двигатель и трансмиссия
    Объем двигателя: 492,7 куб.

    40,0 л.с. (29,2 кВт)) при 7250 об / мин
    Крутящий момент: 46,5 Нм (4,7 кгс-м или 34,3 фут-фунт) при 5500 об / мин
    Степень сжатия: 10. 5: 1
    Диаметр цилиндра x ход: 94,0 x 71,0 мм (3,7 x 2,8 дюйма)
    Клапаны на цилиндр: 4
    Топливная система: Впрыск . EFI
    Контроль топлива: Одиночные верхние кулачки (SOHC)
    Система охлаждения: Жидкостная
    Коробка передач: Тип коробки передач
    Цепь
    Сцепление: Сухой центробежный тип с демпфирующими пробками
    Трансмиссия: Автоматический поворотный механизм с C.V.T
    Расход топлива: 4,76 л / 100 км (21,0 км / л или 49,42 миль на галлон)
    Парниковые газы: 110,4 CO 2 г / км. (CO2 — выбросы углекислого газа)
    Сведения о выбросах: Euro 3
    Шасси, подвеска, тормоза и колеса
    Тип рамы: Двойная решетчатая опора из высокопрочной стали трубы
    Передняя подвеска: Параллелограмм, состоящий из четырех алюминиевых рычагов, поддерживающих две рулевые трубы, консольная подвеска. Электрогидравлическая система блокировки подвески.
    Ход передних колес: 85 мм (3,3 дюйма)
    Задняя подвеска: Качающийся двигатель, закрепленный на раме с помощью маятника и двух гидравлических амортизаторов двойного действия с четырехпозиционной пружиной предварительная нагрузка.
    Ход заднего колеса: 110 мм (4,3 дюйма)
    Передняя шина: 120 / 70-12
    Задняя шина: 140 / 70-14
    Передние тормоза: Двойной диск.Двухпоршневой суппорт
    Диаметр: 240 мм (9,4 дюйма)
    Задние тормоза: Однодисковые. Двухпоршневой суппорт
    Диаметр: 240 мм (9,4 дюйма)
    Колеса: Диски из алюминиевого сплава, литые под давлением.
    Физические размеры и вместимость
    Сухой вес: 244.0 кг (537,9 фунта)
    Вес, вкл. нефть, газ и т. д .: 260,0 кг (573,2 фунта)
    Соотношение мощность / масса: 0,1639 л.с. / кг
    Высота седла: 785 мм (30,9 дюйма) Если регулируемая, самая низкая настройка.
    Общая длина: 2160 мм (85,0 дюймов)
    Общая ширина: 775 мм (30.5 дюймов)
    Колесная база: 1550 мм (61,0 дюйма)
    Запас топлива: 12,00 литров (3,17 галлона)
    Запас топлива: 1.0008 (0,48 галлона)
    Другие характеристики
    Варианты цвета: Nero Demon, Grigio Opaco
    Стартер: Электрический
    09 цифровые инструменты
    Комментарии: Два передних колеса. Механический стояночный тормоз блокирует заднее колесо.
    Дополнительная информация
    Стоимость страховки Сравните расценки на страхование в США от ведущих поставщиков услуг в стране.
    Варианты финансирования Сравните предложения по кредитам на мотоциклы в США от ведущих национальных поставщиков.
    Поиск запчастей Chaparral предоставляет онлайн-схемы и запчасти OEM для США. Revzilla предлагает скидки до 50% на аксессуары для мотоциклов.Доставка в большинство стран.
    Также ознакомьтесь с нашим обзором интернет-магазинов мотоциклов на Bikez.info.
    Задавайте вопросы Присоединяйтесь к дискуссионной группе 16 Gilera Fuoco 500 или общей дискуссионной группе Gilera.
    Сопутствующие велосипеды Перечислите связанные велосипеды для сравнения характеристик.

    GILERA FUOCO 500 ie 4T LC евро 3

    Malossistore. eu sirve muchos países y en cada país tiene conditiones especiales y promociones.

    Si desea cambiar tu país, por Favor selecciona uno del cuadro de selección de abajo y confirmma tu selección.

    Ваша текущая настроенная страна:

    Selecciona PaísAFGHANISTANÅLAND ISLANDSALBANIAALGERIAAMERICAN SAMOAANDORRAANGOLAANGUILLAANTARCTICAANTIGUA И BARBUDAARGENTINAARMENIAARUBAAZERBAIJANBAHAMASBAHRAINBANGLADESHBARBADOSBELARUSBELGIUMBELIZEBENINBERMUDABHUTANBOLIVIA, Многонациональном СОСТОЯНИЕ OFBOSNIA И HERZEGOVINABOTSWANABOUVET ISLANDBRAZILBRITISH ИНДИЙСКИЙ ОКЕАН TERRITORYBRUNEI DARUSSALAMBULGARIABURKINA FASOBURUNDICAMBODIACAMEROONCANADACAPE VERDECAYMAN ISLANDSCENTRAL АФРИКАНСКИЕ REPUBLICCHADCHILECHRISTMAS ISLANDCOCOS (Keeling) ISLANDSCOLOMBIACOMOROSCONGOCONGO, ДЕМОКРАТИЧЕСКАЯ РЕСПУБЛИКА THECOOK ISLANDSCOSTA RICACÔTE D’IVOIRECROATIACUBACYPRUSCZECH REPUBLICDENMARKDJIBOUTIDOMINICADOMINICAN REPUBLICECUADOREGYPTEL SALVADOREQUATORIAL GUINEAERITREAESTONIAETHIOPIAFALKLAND (Мальвинские) острова ФАРЕРСКИЕ ISLANDSFIJIFINLANDFRANCEFRENCH GUIANAFRENCH ПОЛИНЕЗИЯФРАНЦУЗСКИЕ ЮЖНЫЕ ТЕРРИТОРИИ ГАБОНГАМБИАГЕОРГИАГАНАГИБРАЛТАРГРЕЕЦЭГРЕНЛАНДГРЕНАДАГУАДЕЛОУПЕГУАМГУАТЕМАЛАГУЕРНСЕЙГИНЕГВИНА-БИССАУГЯНА ГОРОД ШТАТ) HONDURASHUNGARYICELANDINDIAINDONESIAIRAN, Исламская Республика OFIRAQISLE О MANISRAELJAMAICAJAPANJERSEYJORDANKAZAKHSTANKENYAKIRIBATIKOREA ДЕМОКРАТИЧЕСКАЯ НАРОДНАЯ РЕСПУБЛИКА OFKOREA, РЕСПУБЛИКА OFKUWAITKYRGYZSTANLAO НАРОДНАЯ ДЕМОКРАТИЧЕСКАЯ REPUBLICLATVIALEBANONLESOTHOLIBERIALIBYAN АРАБСКИЕ JAMAHIRIYALIECHTENSTEINLITHUANIALUXEMBURGMACEDONIA, бывшая югославская Республика OFMADAGASCARMALAWIMALAYSIAMALDIVESMALIMALTAMARSHALL ISLANDSMARTINIQUEMAURITANIAMAURITIUSMAYOTTEMEXICOMICRONESIA, Федеративные Штаты OFMOLDOVA, РЕСПУБЛИКА OFMONACOMONGOLIAMONTENEGROMONTSERRATMOROCCOMOZAMBIQUEMYANMARNAMIBIANAURUNEPALNETHERLANDSNETHERLANDS ANTILLESNEW CALEDONIANICARAGUANIGERNIGERIANIUENORFOLK ISLANDNORTHERN MARIANA ISLANDSNORWAYOMANPAKISTANPALAUPALESTINIAN ТЕРРИТОРИЯ, OCCUPIEDPANAMAPAPUA NEW GUINEAPARAGUAYPERUPHILIPPINESPITCAIRNPOLANDPORTUGALPUERTO RICOQATARREUNIONROMANIARUSSIAN FEDERATIONRWANDASAINT BARTHÉLEMYSAINT HELENASAINT KITTS, NEVISSAINT LUCIASAINT MARTINSAINT PIERRE, MIKELONSAINT VINCENT AND THE GRENADI NESSAMOASAO ТОМ И PRINCIPESAUDI ARABIASENEGALSERBIASEYCHELLESSIERRA LEONESINGAPORESLOVAKIASLOVENIASOLOMON ISLANDSSOMALIASOUTH AFRICASOUTH ГРУЗИЯ И Южные Сандвичевы ISLANDSSRI LANKASUDANSURINAMESVALBARD И ЯН MAYENSWAZILANDSWEDENSWITZERLANDSYRIAN АРАБ REPUBLICTAJIKISTANTANZANIA, Объединенная Республика OFTHAILANDTIMOR-LESTETOGOTOKELAUTONGATRINIDAD И TOBAGOTUNISIATURKEYTURKMENISTANTURKS И КАЙКОС ISLANDSTUVALUUGANDAUKRAINEUNITED АРАБ EMIRATESUNITED STATESUNITED Внешних малые острова ISLANDSURUGUAYUZBEKISTANVANUATUVENEZUELAVIET NAMVIRGIN, BRITISHVIRGIN ОСТРОВ, У. С.УАЛЛИС И ФУТУНАВЕСТЕРН САХАРАЙМЕНЗАМБИАЗИМБАБВЕ
    Подтверждать

    GILERA FUOCO 500 LT 2017 493cc SCOOTER цена, характеристики, видео

    Краткая информация и обзор:

    Мотоцикл Gilera FUOCO 500 LT 2017 года — это самокат.
    Год выпуска: • 2017 • 2016 2015 2014 SCOOTER
    Отличия от предыдущего года (2016): цена снизилась на 0,72% (с 8.290 — 8.230)

    Moto Specifications:

    Help / Instructions — click here

    Instructions Столбец MIN : наименьшее значение элемента спецификации для мотоциклов SCOOTER, MAX : наибольшее значение для мотоциклов SCOOTER, AVG / # : среднее значение SCOOTER / количество мотоциклов SCOOTER, для которых записан этот элемент спецификации
    Зеленый фон для значений, которые совпадают с MIN, MAX или AVG


    Внимание! Пункты спецификации, которые вы видите, — это те, которые мы записали, если некоторые из них отсутствуют, это не означает, что их нет на конкретном мотоцикле. Это может означать, что мы либо не нашли его на веб-сайте производителя / производителя / импортера, либо вы не являетесь участником, чтобы видеть больше элементов спецификации, как это делают участники, либо что мы еще не завершили исследование для конкретного мотоцикла. Если вам известно, что какой-то элемент в спецификации отсутствует или значение указано неверно, вы можете помочь нам, сообщив нам, чтобы мы могли исправить это.

    Окончательная цена в евро (с НДС)

    8.230,00

    850,00 14.200,00 3.408,75 / 1688

    Мощность (л.с.)

    40,15 (39,6 л.с.)

    Отношение мощности к массе л.с. / кг

    0,15 (* Рассчитано на основе расчетной полной массы + — 5%)

    Комбинированный расход (л / 100 км)

    4,76

    Тип распредвала верхнего расположения

    SOHC

    Компрессия (X)

    10,50 (± 0,5: 1)

    Подача топлива

    Впрыск топлива

    Цвет (Семейство цветов)

    Черный, Серебристый, Красный, Серый

    Яркость цвета

    Темный цвет, нейтральный

    Интенсивность цвета

    Сильный, нейтральный

    Вес с жидкостями (кг)

    268,00 (приблизительный + -5 кг)

    Масса без жидкости (кг)

    253,00

    Тип сцепления

    Автомат, вариатор с центробежным сцеплением, сухой

    Запас топлива (л)

    1,80

    Емкость топливного бака (л )

    12,00

    Блокировка ручки-штанги

    Centra л (от центрального переключателя)

    Индикатор уровня топлива

    Analoque

    Спидометр

    Analoque, электронный

    Индикатор температуры

    Электронный

    Сигнальная лампа поворота

    Две лампы

    Дистанция выхлопа

    Euro II от земли (мм)

    785,00

    Тип передней части

    Амортизаторы

    Регулировка задней части

    Предварительная нагрузка пружины

    Диаметр передней части (мм)

    240,00

    Поршни заднего суппорта #

    2 (плавающий суппорт )

    Размеры переднего колеса

    120 / 70-12

    Материал переднего колеса

    Алюминий (литье)

    Диаметр переднего колеса (мм)

    304,80 (12 дюймов)

    Материал заднего колеса

    Алюминий (литье)

    Диаметр задней части (мм)

    355,60 (14 дюймов)

    Ширина задней части (мм)

    114,30 (4,50 дюйма)

    Ширина передней части (мм)

    90 450 76,20 (3,00 дюйма)

    Длина (мм)

    2. 245,00

    690,00 2,285,00 1,988,36 / 1721

    Колесная база (мм)

    1,550,00

    970,00 1.910,00 1,385 , 32/1679

    Ширина (мм)

    790,00

    360,00 1.135,00 732,50 / 1714

    Относительные объявления мотоциклов:

    Похожие / похожие мотоциклы:

    Одинаковый тип и марка, рабочий объем:
    от 370 до 616 куб. , объем такого же типа:
    от 370 до 616 куб.см

    PEUGEOT GEOPOLIS 400 2020

    Другой марки, рабочий объем того же типа:
    от 370 до 616 куб.см

    KYMCO XCITING-S 400I ABS NOODOE 2020

    Другой марки, такой же объем :
    f от 370 до 616 куб.см

    KYMCO XCITING 400i ABS 2020

    Другая марка, рабочий объем того же типа:
    от 370 до 616 куб.см

    SYM MAXSYM 600 SPECIAL EDITION 2020

    Другой марки, такой же рабочий объем:
    от 370 до 616 куб.

    YAMAHA XMAX 400 2020

    Другой марки, такой же рабочий объем:
    от 370 до 616 куб.см

    SYM MAXSYM TL 2020

    Другой марки, такой же рабочий объем:
    от 370 до 616 куб.см

    SUZUKI ABS 2020

    400

    Другой марки, такой же рабочий объем:
    от 370 до 616 куб.см

    YAMAHA XMAX 400 Tech MAX 2020

    Другой марки, тот же рабочий объем:
    от 370 до 616 куб.см

    YAMAHA XMAX 400 IRON MAX 2020

    Другой производитель, такой же рабочий объем:
    от 370 до 616 куб.см

    PEUGEOT METROPOLIS 400i 12 SBC 2020

    Другой марки, такой же рабочий объем:
    от 370 до 616 куб.см

    KYMCO AK 550i ABS NOODOE 2020

    Ot ее марка, такой же объем двигателя:
    с 370 до 616 куб.см

    PEUGEOT METROPOLIS 400i RX R 13 ABS 2020

    Тот же тип, близкая цена:
    от 6.996 до 9.464 €

    YAMAHA XMAX 400 2020

    Тот же тип, близкая цена:
    от 6.996 до 9.464 €

    SYM MAXSYM TL 2020

    Тот же тип, близкая цена:
    от 6. 996 до 9.464 €

    SUZMUKI 400 2020

    Тот же тип, цена закрытия:
    от 6,996 до 9,464 €

    YAMAHA XMAX 400 Tech MAX 2020

    Тот же тип, цена закрытия:
    от 6,996 до 9,464 €

    YAMAHA XMAX 400 IRON MAX 2020

    Такой же тип, цена закрытия:
    от 6.996 до 9.464 €

    BMW C 400 GT 2020

    Тот же тип, близкая цена:
    от 6.996 до 9.464 €

    PEUGEOT METROPOLIS 400i 12 SBC 2020

    Тот же тип, близкая цена:
    от 6.996 до 9.464 €

    PIAGIO MP3 350 2020

    Тот же тип, близкая цена:
    от 6,996 до 9,464 €

    KYMCO AK 550i ABS NOODOE 2020

    Тот же тип, близкая цена:
    от 6,996 до 9,464 €

    PEUGEOT METROPOLIS 400i RX R 13 ABS 2020

    Аксессуары

    У вас есть магазин аксессуаров с аксессуарами для GILERA — FUOCO 500 LT (2017) SCOOTER? Свяжитесь с нами, чтобы представить их здесь

    Запчасти

    Есть ли у вас интернет-магазин запчастей для GILERA — FUOCO 500 LT (2017) SCOOTER? Свяжитесь с нами, чтобы представить их здесь

    Gilera Fuoco 500 Обзор | Новости и обзоры скутеров

    Обзор скутера

    Gilera Fuoco 500 Обзор

    Если пришло время поднять свой опыт вождения на новый уровень, то пора прокатиться на Gilera Fuoco 500

    Allen Drysdale

    Вам нужен javascript. и Flash Player 9 для воспроизведения этого видео

    Gilera Fuoco — большой папа в семье MP3.Конечно, у него такая же трехколесная передняя часть, обеспечивающая превосходное сцепление с дорогой, и да, он имеет тот же эффект поляризации, что и весь диапазон MP3 на всех, кто его видит. Но Gilera берет титул «большого папочки» за агрессивную переднюю часть квадроцикла «богомол, приходите, расхитительница гробниц» и «больше и лучше остальных» 492-кубовый двухискровый двигатель.

    Но в первую очередь стиль. У меня был Fuoco около месяца, и за это время я никогда так много не говорил ни о одном скутере. Быстрый спуск к магазинам может превратиться в часовую экспедицию, поскольку любопытные зеваки собираются вокруг, чтобы посмотреть на Fuoco, и после короткого периода беспокойства возникает вопрос: «Что это?»

    Видите ли, ничто другое не может сравниться с трубчатой ​​передней частью Fuoco; агрессивный вид может быть более уместным на съемках фильма «Безумный Макс» или «Расхитительница гробниц». Открытые рули и задняя часть багажника только добавляют прочный и практичный дизайн. Даже стоя на месте, Fuoco имеет внушительную и мощную стойку. Поэтому, когда вы едете на Fuoco, вы не можете стесняться, а если да, то, возможно, наденьте полный шлем с тонированным козырьком, так как у каждого будет свое мнение или вопрос. Так что будь готов.

    Но наибольший интерес вызывают два передних колеса. MP3-файлы группы Piaggio доступны здесь уже довольно давно, но они все еще рассматриваются как диковинка, а не как динамический и технический шедевр, которым они на самом деле являются.Я никогда не ездил на чем-то, что внушало бы уверенность переднего конца, как Fuoco. Он обладает удивительной способностью обеспечивать непоколебимую устойчивость и сцепление с дорогой, гарантируя, что куда вы укажете, это путь, по которому вы выберете.

    Вы ездите на Fuoco, как на любой другой двухколесной машине. Распространенным заблуждением является тот факт, что некоторые думают, что передняя часть самобалансируется, но это не так. Передняя часть ни в коем случае не имеет трения, подпружинения или самовосстановления. MP3 и Fuoco — это не трициклы, как мы их обычно знаем.После выхода из режима блокировки Fuoco может свободно перемещаться из стороны в сторону с плавностью, противоречащей его впечатляющему внешнему виду. Конечно, вам нужно привыкнуть к ощущению небольшого лишнего веса впереди, но если бы вы катались на Fuoco каждый день, то вы бы к нему быстро привыкли.

    Любое дорожное покрытие, я имею в виду любое дорожное покрытие, становится менее опасным как в вашем сознании, так и в реальности. Ямы, перекрестки с круговым движением, трамвайные пути, крышки люков и мокрые покрытия для нас, обычных двухколесных жокеев, — это просто дело прошлого.Оба передних колеса работают в унисон, создавая вдвое большую площадь основания, чем любой обычный двухколесный транспорт, в результате чего обеспечивается надежное сцепление с дорогой на поворотах и ​​при торможении, которые просто поразят вас. Сдвоенные задние амортизаторы хорошо дополняют потрясающую переднюю часть Fuoco и при необходимости предлагают широкие возможности регулировки для переноски задних колес.

    Fuoco — настоящий воин на дороге. Во всем городе это потрясающая машина точка-точка. Сначала вы могли подумать, что он немного широк для некоторых щелей, но вскоре вы поймете, что ширина Fuoco примерно равна ширине его руля.Так что не игнорируйте Fuoco как городского жителя, поскольку мучительные городские условия — это именно то, для чего он предназначен. На открытой дороге больший объем двигателя Fuoco поглощает мили за городом, хотя заводской «короткий» экран оставит вас немного незащищенными. Это легко исправить с помощью более высокого экрана, доступного в каталоге опций Gilera, что делает путешествие по автостраде комфортным и реалистичным.

    И пока мы говорим о Fuoco в движении, мы должны упомянуть двухискровой двигатель.Я ездил на своей изрядной доле скутеров, оснащенных почтенным двигателем Piaggio «Master», и версия с двумя искрами, которая приводит в движение Fuoco, является настоящей жемчужиной. Мощный, плавный и бодрый — это то, что я обычно не ассоциирую с итальянскими большими синглами, но Fuoco меняет это восприятие и кажется несколько утонченным. Двойные свечи зажигания Fuoco обеспечивают чистую и тщательную детонацию топливно-воздушной смеси, что увеличивает мощность при одновременном снижении расхода топлива и выбросов. Ездить на самом деле одно удовольствие, и позвольте мне повторить; Поездка на большом Gilera по городу не составляет труда, поскольку крутящий момент этого двигателя и чувство срочности сделают то, что вы хотите и когда захотите, с уровнем совершенства, который отличается от других больших одноцилиндровых машин.

    Сидение на Fuoco расслабленное и удобное. Подушка сиденья плоская, но не слишком жесткая, и до нее легко добраться до открытых рулей, напоминающих квадроцикл. Все находится в правильном положении для простоты использования, и единственное, о чем вам нужно беспокоиться на Fuoco, — это переключатель для электронной блокировки и разблокировки передней части. Вы можете сделать это, когда двигаетесь медленно или неподвижно, что является жемчужиной при парковке или просто остановке на светофоре. Центральная подставка устарела! Поворот дроссельной заслонки отменяет функцию электронной блокировки, поэтому вы не можете случайно врезаться в первый угол с самокатом в вертикальном положении, как барный стул, а датчик давления в сиденье не дает двигателю набрать обороты (и тем самым разблокировать переднюю часть). конец), если вы на самом деле не сидите на скуте.

    Еще кое-что меня удивило. Зная, что у Fuoco отсутствует задняя «крышка», как у его братьев и сестер MP3, я все еще был впечатлен объемом памяти. Полнолицевой шлем и другие аксессуары, такие как куртка, легко поместятся под сиденьем Fuoco и будут надежно заперты. А если вам нужно больше нести, то у вас есть множество точек крепления и места для хранения на задней стойке.

    Многофункциональная приборная панель позволяет сразу получить всю информацию.А если вам нужно проверить счетчик пройденного пути или узнать, насколько холодно, вы можете просмотреть различные настройки с помощью переключателя режимов на руле, который находится в пределах досягаемости. Огромный аналоговый спидометр и тахометр дополняют спортивное наследие бренда Gilera и обеспечивают удобный визуальный ориентир.

    Fuoco подвергся критике из-за того, что задняя часть не поспевает за технически более совершенной передней частью, или Fuoco слишком тяжелый и требует большей мощности. Многие скажут, что вам никогда не бывает достаточно ворчания, но, поднявшись на одну или две, мощность и крутящий момент Fuoco были достаточными.Я был более чем впечатлен двухискровым двигателем объемом 492 куб. См; сравнивая его со старым «Мастером», а для меня это мел и сыр. С другой стороны, критика его управляемости будет проблемой только против специально созданного спортивного мотоцикла в среде типа гоночной трассы. Fuoco — это машина в своей собственной лиге; так уверенно, это безумие, и я ни разу не смог найти предел сцепления Fuoco в нормальных условиях катания.

    Вот и все. Единственная причина, по которой вы могли когда-либо отказаться от Gilera, заключалась в том, что его диковинный стиль был слишком большим, чтобы жить с ним.Кто-то может сказать, что при цене 13990 долларов это немного дорого; но смиритесь с этим, как и я в течение длительного периода, и вы увидите ценность Gilera. Дополнительное сцепление, внушающее уверенность управление и повышенный уровень безопасности, которые Gilera имеет по сравнению со стандартной двухколесной машиной, просто имеют для меня значение. И не говоря уже обо всех других особенностях скутера, которые нам нравятся, таких как хранение, защита и простота поворота.

    Gilera Fuoco 500, вы получаете мой голос в любой день недели.

    , опубликовано 25.08.2009

    Свеча зажигания -PIAGGIO- Gilera Fuoco | Пункты GP A 01

    Функциональные файлы cookie для непрерывной функциональности интернет-магазинов.Diese Cookies ordnen Ihrem Browser eindeutige zufällige ID zu damit Ihr ungehindertes Einkaufserlebnis über mehrere Seitenaufrufe hinweg gewährleistet werden kann.

    Сессия:

    Das Session Cookie speichert Ihre Einkaufsdaten über mehrere Seitenaufrufe hinweg und ist somit unerlässlich für Ihr persönliches Einkaufserlebnis.

    Меркцеттель:

    Das Cookie ermöglicht es einen Merkzettel sitzungsübergreifend dem Benutzer zur Verfügung zu stellen. Damit bleibt der Merkzettel auch über mehrere Browsersitzungen hinweg bestehen.

    Gerätezuordnung:

    Die Gerätezuordnung hilft dem Shop dabei für die aktuell aktive Displaygröße die bestmögliche Darstellung zu gewährleisten.

    CSRF-токен:

    Das CSRF-Token Cookie trägt zu Ihrer Sicherheit bei. Es verstärkt die Absicherung bei Formularen gegen unerwünschte Hackangriffe.

    Токен входа:

    Der Login Token dient zur sitzungsübergreifenden Erkennung von Benutzern. Das Cookie enthält keine persönlichen Daten, ermöglicht jedoch eine Personalisierung über mehrere Browsersitzungen hinweg.

    Кэш Ausnahme:

    Das Cache Ausnahme Cookie ermöglicht es Benutzern Individual Inhalte unabhängig vom Cachespeicher auszulesen.

    Cookies Aktiv Prüfung:

    Das Cookie wird von der Webseite genutzt um herauszufinden, ob Cookies vom Browser des Seitennutzers zugelassen werden.

    Cookie Einstellungen:

    Das Cookie wird verwendet um die Cookie Einstellungen des Seitenbenutzers über mehrere Browsersitzungen zu speichern.

    Herkunftsinformationen:

    Das Cookie speichert die Herkunftsseite und die zuerst besuchte Seite des Benutzers für eine weitere Verwendung.

    Cache Ausnahme Versandart:

    Das Cache Ausnahme Versandart Cookie ermöglicht es Benutzern Individualuelle Versandart-bezogen Inhalte unabhängig vom Cachespeicher auszulesen.

    Fahrzeugnavigation ausgewählter Navigationspfad:

    Das Fahrzeugnavigation ausgewählter Navigationspfad Cookie wird verwendet um die Auswahl in allen vier Feldern in der Fahrzeugnavigation zu speichern und die Auswahl über all Seiten hinweg für den Benutzer zu erhalten.

    Fahrzeugnavigation ausgewähltes Fahrzeug / Cache Ausnahme:

    Das Fahrzeugnavigation ausgewähltes Fahrzeug Cookie wird verwendet um die Auswahl des отдельных Fahrzeugs zu speichern und die Auswahl über all Seiten hinweg für den Benutzer zu erhalten. Zusätzlich ermöglicht es Benutzern Individualuelle Fahrzeug-bezogen Inhalte unabhängig vom Cachespeicher auszulesen.

    Fahrzeugnavigation ausgewähltes Fahrzeug / Cache Ausnahme:

    Das Fahrzeugnavigation ausgewähltes Fahrzeug Cookie wird verwendet um die Auswahl des отдельных Fahrzeugs zu speichern und die Auswahl über all Seiten hinweg für den Benutzer zu erhalten. Zusätzlich ermöglicht es Benutzern Individualuelle Fahrzeug-bezogen Inhalte unabhängig vom Cachespeicher auszulesen.

    Anzahl Artikel pro Seite:

    Das Anzahl Artikel pro Seite Cookie ermöglicht es den Benutzern die ausgewählte Anzahl der Artikel pro Seite in einer Artikel Liste über all Listenansichten hinweg im Shop für den Benutzer zu erhalten.

    Варенкорб:

    Das Cookie ermöglicht es den Warenkorb über mehrere Browsersitzungen hinweg zu speichern.

    Партнерская программа:

    Das Cookie dient dazu hervorgerufenen Umsatz von Direktlinks von anderen Plattformen umsatztechnisch auszuwerten.

    Полоса:

    Das Cookie wird vom Zahlungsanbieter genutzt um die Sicherheit bei der Abwicklung von Zahlungen auf der Webseite zu erhöhen.

    Amazon Pay:

    Das Cookie wird für Zahlungsabwicklungen über Amazon eingesetzt.

    Piaggio Gilera Fuoco — продажа велосипедов.com.au

    Big & Butch

    ЧТО НАМ ПОНРАВИЛОСЬ

    • Выдающийся внешний вид и отделка
    • Высокие средние характеристики
    • Универсальность

    НЕ ТАК БОЛЬШАЯ

      Относительно

      и тяжелый для скутера

    РЕЙТИНГИ: Общий рейтинг: 4,1 / 5,0
    Двигатель / трансмиссия: 4,0 / 5,0
    Шасси: 4,0 / 5,0
    Цена, упаковка и практичность: 4. 0 / 5,0
    В седле: 4,0 / 5,0
    X-фактор: 4,5 / 5,0

    08 Цена: $
    ОСНОВНЫЕ СТАТИСТИКИ
    Двигатель: 4-тактный двигатель объемом 492 куб. См, одинарный впрыск топлива
    Коробка передач: полностью автоматическая
    Мощность / крутящий момент: 40 л.с. при 7250 об / мин; 4,3 кг-м при 5500 об / мин
    Вес: 244 кг
    Запас топлива: 12 л
    Высота сиденья: 785 мм

    ОБЗОР
    Piaggio (в который входят скутеры брендов Vespa и Gilera) по-настоящему высунула свою корпоративную шею, когда выпустила концепт наклонного трехколесного автомобиля в форме первоначально MP3 250.Примет ли рынок столь дико выглядящие гаджеты, и если да, то кто их купит?

    По всем сообщениям, показатели продаж солидные, и устройства получили восторженные отзывы мотоциклетных СМИ. Что касается серии MP3, компания придерживалась адаптации необычной передней части с двумя колесами к уже принятой технологии — по сути, к платформе X8.

    Когда дело дошло до престижного и в некотором роде экзотического бренда Gilera, команда решила использовать его хорошо зарекомендовавший себя сингл с инжекторным двигателем объемом 492 куб. См и приложить максимум усилий для стилизации.Конечный результат — это, безусловно, самое жестокое животное, которое когда-либо пробивалось в выставочный зал самокатов. Это потрясающая игрушка сама по себе.

    ЦЕНЫ И ОБОРУДОВАНИЕ
    Цена в размере 12 990 долларов плюс ORC является лучшей в мире скутеров и была снижена, чтобы теперь включать дорожные расходы в качестве разовой акции. В этом ценовом сегменте не так много скутеров, но Fuoco довольно хорошо складывается в этой компании с ограниченной ответственностью.

    Это не самый быстрый скутер (честь, которая остается за Suzuki 650 Burgman), но он достаточно быстр с заявленной и правдоподобной максимальной скоростью 143 км / ч.

    Место складывания находится в прилагаемом оборудовании. Он очень хорошо закончен, имеет, пожалуй, самую красивую черту в мире самокатов, и имеет множество дополнений. Последние включают в себя очень обширный (и функциональный) комплект осветительных приборов, багажную полку сзади и, конечно же, эту специальную переднюю часть с двумя колесами.

    Ящика под сиденьем достаточно, но ничего особенного для своего размера. Я бы хотел установить заводскую приставку, чтобы увеличить ее гибкость.

    ПРИВОДНОЙ ДВИГАТЕЛЬ
    Силовая установка объемом 492 куб.см. уже некоторое время используется нами в различных вариантах и ​​является зарекомендовавшим себя.На низких оборотах он немного комковат, но раскручивается охотно и имеет очень полезные средние частоты. Отклик дроссельной заслонки четкий, а расход топлива скромный для такой большой машины — 20-22км / л.

    Его трансмиссия с раздвижным шкивом не преподносит никаких сюрпризов — щадящий начальный взлет и плавный переход оттуда.

    ШАССИ
    В этом пакете используется версия шасси MP3 с длинной колесной базой, что в сочетании с мощной силовой установкой и большой надстройкой означает, что это не легковес для городских условий.Это солидный мотоцикл.

    Однако он отлично справляется с рычанием в час пик и не является обычным городским животным. Огромная масса приемлема в городе и действительно работает на шоссе. Затем он становится сверхстабильной платформой с достаточной производительностью. Наличие пассажира минимально влияет на производительность.

    Подвеска хорошо подобранная, с ошибкой в ​​части комфорта и способна легко справляться с неровностями и неожиданностями в середине поворота. Это, в сочетании с огромным дополнительным сцеплением, обеспечиваемым вторым колесом, делает его сверхбезопасным и надежным — особенно в сложных условиях.Регулировка ограничивается предварительным натягом пружины (или дорожным просветом) на обоих концах.

    Торможение — это работа по подтягиванию полностью загруженной машины — опять же, дополнительное сцепление с передней частью помогает — и обеспечивает приличное ощущение.

    Уникальной особенностью является то, что вы можете заблокировать переднюю часть в вертикальном положении на очень низкой скорости и в состоянии покоя. Он разблокируется, когда вы взлетаете.

    УПАКОВКА
    На мой взгляд, он выглядит и ощущается как продукт премиум-класса и, тем не менее, имеет разумную цену.

    Все трехколесные модели корпоративной линейки являются предметом обсуждения — пройдет много времени, прежде чем люди привыкнут видеть, как они передвигаются, и, возможно, много лет для этой дикой версии.

    КОНКУРЕНТЫ
    Теоретически Fuoco относится к одному классу. Прямого конкурента нет. Ближайший соперник — очень быстрый и мощный двухцилиндровый Burgman 650 от Suzuki, который стоит примерно столько же. Это более обычная машина с точки зрения шасси и дизайна, с большим пространством под сиденьем. У Yamaha и Honda также есть хорошо подобранные самокаты с большим диаметром цилиндра, на которые стоит обратить внимание.

    В ДОРОГЕ
    Поездка на любом из этих трехколесных транспортных средств доставляет удовольствие и должна вызывать у вас улыбку на циферблате. Я очень привязан к этому, потому что он обладает огромной производительностью и выглядит на миллион долларов.

    Это не самая быстрая машина, и она лучше работает вдали от загруженных дорог. Пока вы можете справиться с этим, у вас будет мяч. Управляемость хорошая, а производительности вполне достаточно, чтобы заинтересовать большинство людей.

    Смотрите видеообзор.

    Выхлоп Akrapovic Titanium Ce Approved Gilera Fuoco 500 I E — S-pi4so3-hrssbl — Глушители

    Код выхлопа: S-PI4SO3-HRSSBL

    Внимание: глушитель одобрен только для акустической эмиссии для разрешений на выбросы загрязняющих веществ. НЕОБХОДИМО купить катализатор, код: P-KAT-040

    Больше очарования для вашего велосипеда

    Индекс производительности

    , увеличение мощности, уменьшение общего веса, больший крутящий момент, привлекательный звук, Акрапович обещает и поддерживает изменение характера мотоцикла.Глушители Akrapovic рождаются из заботы, преданности и страсти к миру мотоциклов. Всегда ведущая компания, она может похвастаться уникальными и передовыми производственными процессами, такими как процесс гидроформовки выхлопных каналов, благодаря которому достигается равномерный изгиб трубы без точек напряжения материала. Глушитель S-PI4SO3-HRSSBL из стали с черным покрытием, а также глушитель с уникальным звуком, который знает только Акрапович, красиво разработанный специально для форм вашей Gilera Fuoco 500 i.е. Глушитель Akrapovic не требует переназначения блока управления двигателем, он также поставляется со всем необходимым для сборки: зажимами, уплотнительными болтами и любыми кронштейнами и фитингами.

    Характеристики

    • Типология: одинарный выхлоп
    • Сертифицирован: E9
    • Сертификат акустической эмиссии
    • Материал: сталь
    • Поверхность: черный
    • В коробке: Есть все необходимое для сборки.

    Настоящее и будущее соревнований

    Akrapovic — одна из первых компаний в мире, которая сделала первые шаги в исследовании и разработке выхлопных систем для мотоциклов, глушителей, мотоциклетных и автомобильных терминалов.

    Добавить комментарий

    Ваш адрес email не будет опубликован. Обязательные поля помечены *